PRGDB00068433 (Ghi.8290)

From PRG Wiki
Jump to: navigation, search
Ghi.8290
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164242023 (ES830039)
Gene Class Unknown
Domain Type
Gene Species Gossypium hirsutum

Comment?

UFL_219_67 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGCACGAGGCAAGCTCAAGGACTGTTTGTGTAATGGATGCTTCCGGCCACCTTGGCTCCGCCCTTGTTCACTTGCTCTTACATAGAGGCTACACTGTTCATGCTGCCCTTCAACCCCATCCAAATGGGTTCCAATCAGTTGAGGAGCTGTTGCCTAGTAGTAATAAAAATTTGAAGATATTCGATGCAGACCCTTTTGATTACCACAGCATTACAGCTGCATTGAAGGGATGTTGTGGTTTATTCTACTGCTTTCAGCCTCCATCTGACCATTCTACTTATGATGAATTCATGGCGGAAATTGAGGCAAGAGCTGCACACAATGTGTTGGAAGCATGTGCTCAAACAGATACAATAGAGAAGGTGGTTTTCACATCCTCCGTAACCGCCGTCATATGGAACGAAAGTCGAACTGGTTCCGACCTGGACGAAAAGAACTGGACCGACATCAATTTTTGCAAGAAGTTTAAGTTATGGCATGCACTGTCGAAAACGTTGGCGGAAAAGTCAGCTTGGGCACTGGCAATGGACCGAGGCATAAACATGGTGACCATTAATGGAGGATTGTTGATGACGCCTGACCTAACCATCACAAATCCATATCTAAAAGGAGCAGCTGAGATGTATGAAGATGGGGTATTTGTTACAGTGGATCTAAGGTTCATAGCCGACGCTCATATTTGTGTGTTCGAAGATGTATCATCGTATGGACGATATCTATGCTTCAACCATGTAATCAATTGCAGCCATGATGCTGATAAACTTGCTCAAATGCTATTACCATCCTCTGATCCTTCACCTCCTCAAAGTTGGGAAAAGGCGAGAATCTACCAGCAAAGAATAAGCAATAAGAAGTTGAACAATTTGATGATGGAGTTTGAGAATGATCTACTTTTAAAACAATTGATTTATGGGATTGCTGCCCTTTATTTGTTTAAAAGAAAAATTATGGTTAACTCAAAACCCGGACGATGGTATTTACCACAAATCCAAATACGGGGAATTTTAGGGaaaaaaaataagtttttgtaaaaatagggtacaaaaaatttaggaatatccctcaaatttttttatattttttttaaagaatttaaaattgttttaaatttaaaaaaaaaaaaaaaaaaaaaataaactcccaaaaaaaattcttaaagaggggccccggggggccccactcaaatttttcccccccgggtgggggggTAACAAGGAAAAAGAGACCCCC


Protein sequences

Name Description Sequence
Ghi.8290 translated coding region predicted by ESTScan from UniGene Ghi.8290

XHEASSRTVCVMDASGHLGSALVHLLLHRGYTVHAALQPHPNGFQSVEELLPSSNKNLKIFDADPFDYHSITAALKGCCGLFYCFQPPSDHSTYDEFMAEIEARAAHNVLEACAQTDTIEKVVFTSSVTAVIWNESRTGSDLDEKNWTDINFCKKFKLWHALSKTLAEKSAWALAMDRGINMVTINGGLLMTPDLTITNPYLKGAAEMYEDGVFVTVDLRFIADAHICVFEDVSSYGRYLCFNHVINCSHDADKLAQMLLPSSDPSPPQSWEKARIYQQRISNKKLNNLMMEFENDLLLKQLIYGIAALYLFKRKIMVNSKPGRW


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
3-304 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

EASSRTVCVMDASGHLGSALVHLLLHRGYTVHAALQPHPNGFQSVEELLPSSNKNLKIFDADPFDYHSITAALKGCCGLFYCFQPPSDHSTYDEFMAEIEARAAHNVLEACAQTDTIEKVVFTSSVTAVIWNESRTGSDLDEKNWTDINFCKKFKLWHALSKTLAEKSAWALAMDRGINMVTINGGLLMTPDLTITNPYLKGAAEMYEDGVFVTVDLRFIADAHICVFEDVSSYGRYLCFNHVINCSHDADKLAQMLLPSSDPSPPQSWEKARIYQQRISNKKLNNLMMEFENDLLLKQLIY

HMMPanther: PTHR10366
3-304 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

EASSRTVCVMDASGHLGSALVHLLLHRGYTVHAALQPHPNGFQSVEELLPSSNKNLKIFDADPFDYHSITAALKGCCGLFYCFQPPSDHSTYDEFMAEIEARAAHNVLEACAQTDTIEKVVFTSSVTAVIWNESRTGSDLDEKNWTDINFCKKFKLWHALSKTLAEKSAWALAMDRGINMVTINGGLLMTPDLTITNPYLKGAAEMYEDGVFVTVDLRFIADAHICVFEDVSSYGRYLCFNHVINCSHDADKLAQMLLPSSDPSPPQSWEKARIYQQRISNKKLNNLMMEFENDLLLKQLIY

Gene3D: G3DSA:3.40.50.720
IPR016040
6-238 no description
NAD(P)-binding domain

SRTVCVMDASGHLGSALVHLLLHRGYTVHAALQPHPNGFQSVEELLPSSNKNLKIFDADPFDYHSITAALKGCCGLFYCFQPPSDHSTYDEFMAEIEARAAHNVLEACAQTDTIEKVVFTSSVTAVIWNESRTGSDLDEKNWTDINFCKKFKLWHALSKTLAEKSAWALAMDRGINMVTINGGLLMTPDLTITNPYLKGAAEMYEDGVFVTVDLRFIADAHICVFEDVSSYGR

superfamily: SSF51735
7-257 NAD(P)-binding Rossmann-fold domains

RTVCVMDASGHLGSALVHLLLHRGYTVHAALQPHPNGFQSVEELLPSSNKNLKIFDADPFDYHSITAALKGCCGLFYCFQPPSDHSTYDEFMAEIEARAAHNVLEACAQTDTIEKVVFTSSVTAVIWNESRTGSDLDEKNWTDINFCKKFKLWHALSKTLAEKSAWALAMDRGINMVTINGGLLMTPDLTITNPYLKGAAEMYEDGVFVTVDLRFIADAHICVFEDVSSYGRYLCFNHVINCSHDADKLAQ

HMMPfam: PF13460
10-159 NAD_binding_10,NADH(P)-binding

CVMDASGHLGSALVHLLLHRGYTVHAALQPHPNGFQSVEELLPSSNKNLKIFDADPFDYHSITAALKGCCGLFYCFQPPSDHSTYDEFMAEIEARAAHNVLEACAQTDTIEKVVFTSSVTAVIWNESRTGSDLDEKNWTDINFCKKFKLW

Seg: seg
261-270 seg

PSSDPSPPQS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox