PRGDB00068435 (Ghi.8349)

From PRG Wiki
Jump to: navigation, search
Ghi.8349
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 31074048 (CA994327)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

P05-4 Pst1-P fragment Gossypium hirsutum cDNA 5', mRNA sequence

DNA Sequence

AACCAGTTAATTTGATTTATAGTGAGTATTATGTGAAAATATCAAGCTAACACAATATTACACATATTACAATAAGTAGCAATAAGGACTAAATCCTCGGGGTTAATTAATATTACAAGCTTGATTTATTGGAGATGATATTGCACAAGAAATCATCAATTTCAGCAAATACAAAATAAAGAGGAAAATGTGAACCAAATATAATATCTAAAATACATGACACAACTAAATAGAACTGAAAAATGAAGTTGGGCAGGGAGGTATGGGGATCTCAACTGTCCCTTCCAACATCAACAGTACCTTTTTCATGGAAGGGCGCAGTGTTGGTTCATCCAGGATGCACCACAGTCCTACAATCACCATCCTTTCAAGTTGTTTTATATCCACCTCCTCATCTTCTCCTACTATCTTCCCTACCTCACCGGCTTGGTAACGATCGTAGACCCATTCTTCAAGGACAGCTTCTTCGTCCTTGAGGCTCCAATTTACACTTCGTCGACAACATATGATCTCCAATAATACGATCCCGAAGCTGTAAACATCTGCTTTTACTGTCACCGGTAGTTTCCTGTGCCACTCTGGTGCAACGTACCCCCTTGTTCCTCTGATCCCAGTGAAGGTCTTGGTTTGGTCTGGCTTTAGCAACTTGGCCAATCCGAAATCGGATATTTTCGCTTCCCCGTTTTCGTCCATTAGTATGTTCTGAGACTTGATGTCACAATGGATTATTTGAGTCTCGCATTCTTCATGAAGATACAGGAGACCTCGAGCTACGTCGCGAGCGATTTCCACCCTATCGATCCAACAAGGTCGTCTTTCGGGTGTAAAGAGTACATCGGAAAGTGATCCATTGATCATATACTCGTATATCAACAGCCTATTAGCTCCATCATGGCAGTATCCTAGTAGTCGAACTAAGTTTCGATGATGAGTTCTCCCAATGATTCGCATCTCGTTTTGAAACTCTCGTTCGCCTTGGTTTGATATGTTGTCCAATCTCTTCACTGCCACAACTTTTGTTAAACCATTCAACATTACCGTCCCTTTGAAAACGGCTCGTGC


Protein sequences

Name Description Sequence
Ghi.8349 translated coding region predicted by ESTScan from UniGene Ghi.8349

ARAVFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVLLMLEGTVEIPIPPCPTSFFSSI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-275 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ARAVFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVLLMLEGTVEIPIPPCPTSFF

HMMSmart: SM00219
IPR020635
3-259 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

AVFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVLLML

superfamily: SSF56112
IPR011009
4-277 Protein kinase-like (PK-like)
Protein kinase-like domain

VFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVLLMLEGTVEIPIPPCPTSFFSS

Gene3D: G3DSA:3.30.200.20
4-55 no description

VFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGY

HMMPanther: PTHR24420
4-274 FAMILY NOT NAMED,FAMILY NOT NAMED

VFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVLLMLEGTVEIPIPPCPTSF

HMMSmart: SM00220
IPR002290
4-259 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VFKGTVMLNGLTKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVLLML

HMMPfam: PF00069
IPR017442
15-197 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TKVVAVKRLDNISNQGEREFQNEMRIIGRTHHRNLVRLLGYCHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLK

Gene3D: G3DSA:1.10.510.10
56-256 no description

CHDGANRLLIYEYMINGSLSDVLFTPERRPCWIDRVEIARDVARGLLYLHEECETQIIHCDIKSQNILMDENGEAKISDFGLAKLLKPDQTKTFTGIRGTRGYVAPEWHRKLPVTVKADVYSFGIVLLEIICCRRSVNWSLKDEEAVLEEWVYDRYQAGEVGKIVGEDEEVDIKQLERMVIVGLWCILDEPTLRPSMKKVL

PatternScan: PS00108
IPR008271
112-124 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKSQNILM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox