PRGDB00068436 (Ghi.8422)

From PRG Wiki
Jump to: navigation, search
Ghi.8422
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164329142 (ES808941)
Gene Class Unknown
Domain Type
Gene Species Gossypium hirsutum

Comment?

UFL_302_78 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGCACGAGCAAAAACAGTTAAACGAGTCGTCTTGACATCATCTGCCGCAGCTGTGTCTATCAACACACTGGATGGGACAGATCTCGTCATGACAGAGAAAGACTGGACCGATATCGAGTTCTTATCATCAGCAAAGCCACCAACTTGGGGGTACCCTGCATCCAAGACGTTGGCTGAAAAGGCAGCTTGGAAATTTGCTGAAGAAAACAACATTGATCTCATTACAGTTATCCCTTCTCTCATGACTGGTCCTTCCCTCACCCCAATTGTCCCCAGCAGCATAGGCCTTGCTACATCTTTGATTTCAGGCAATGAATTCCTCATAAATGCTTTGAAAGGAATGCAGATGCTGTCAGGTTCGATCTCTATCACACATGTGGAAGACGTATGCCGAGCCCATGTTTTTCTGGCTGAAAAAGAATCTGCATCGGGTCGATATATATGCAGTGCTGTCAATACCAGTGTGCCAGAACTAGCANAGTTCCTCAACAAAAGATACCCTGACTTCAAAGTCCCTACCGATTTTGGAGATTCCCCCTCCAACCCAAGTTGATCATTTCCTCAGAGAAACTTATTAGCGAAAGATTCAGCTTTAAGTATGGGATCGAGGAAATCTACGACCAAACCGTGGAAATATTGAAGTCTAAGGGGCTGCTCAAGTGGAGCGCTTTGACGCTTCCCCCATGATTATGGTGGTTGACTGGTGTGCTATTGTGATAATATTCGAATAACTTCATGCTCTAACAATGGAAGGCAAAACCGTGTGGGGGTTTGTCTTCTATTTTGAATTaaaaaaaaaaaaaaaaaaaaaaaCTCCGAAAATACTTTCTAGAACGGGCCCCGGGGGCCCTTCAATTTTTCCCCCCCggggggggggTACCAAGGGAAAAGTGTACCCCAAATTCCCCCCCATTAGTGGAGTCCGAATTTCAAATTTCCATGGGCCCGTCCTTTTTTCAAACCGCCCGGACCTGGGGAAAAACCCCTGGGCGGTCATCCCCAACCTTAAATCCGCCTTTGCAAGACCATTCCCCCCTTTTCCCCCAGCTGGGGGTAATAAGCGAAAAAAGgccccgcccccaattccccctttccccAACAATTGGCGCCAGCCCTGGAATGGGGGAAAATGGGAAGATCCCAAATTTTTTAAGGGGGATATAAGGGGGTTAAAAAAACCCTGGAtttttaattttgtttttggggtgtttttttATAAAATTCACACAAACCCCCACAAAGGCGCTCTTTTTTCGGGGccccctcccccctctcccccccacaggactggttttctcttggaatttaaaaaaaaaaaCCCCCCAAACACCCCAAATATTTTTTAGAAGGGAGGtttttttttttttgttgtttttttaaaaaaaaaaaacccccccccacccccccccccccccc


Protein sequences

Name Description Sequence
Ghi.8422 translated coding region predicted by ESTScan from UniGene Ghi.8422

XARAKTVKRVVLTSSAAAVSINTLDGTDLVMTEKDWTDIEFLSSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPSLMTGPSLTPIVPSSIGLATSLISGNEFLINALKGMQMLSGSISITHVEDVCRAHVFLAEKESASGRYICSAVNTSVPELAXFLNKRYPDFKVPTDFGDSXLQPKLIISSEKLISERFSFKYGIEEIYDQTVEILKSKGLLKWSALTLPP

Domains

Domain Start-End Description Sequence

HMMPfam: PF01370
IPR001509
2-147 Epimerase
NAD-dependent epimerase/dehydratase

ARAKTVKRVVLTSSAAAVSINTLDGTDLVMTEKDWTDIEFLSSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPSLMTGPSLTPIVPSSIGLATSLISGNEFLINALKGMQMLSGSISITHVEDVCRAHVFLAEKESASGRY

superfamily: SSF51735
2-216 NAD(P)-binding Rossmann-fold domains

ARAKTVKRVVLTSSAAAVSINTLDGTDLVMTEKDWTDIEFLSSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPSLMTGPSLTPIVPSSIGLATSLISGNEFLINALKGMQMLSGSISITHVEDVCRAHVFLAEKESASGRYICSAVNTSVPELAXFLNKRYPDFKVPTDFGDSXLQPKLIISSEKLISERFSFKYGIEEIYDQTVEILKS

HMMPanther: PTHR10366:SF9
2-221 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

ARAKTVKRVVLTSSAAAVSINTLDGTDLVMTEKDWTDIEFLSSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPSLMTGPSLTPIVPSSIGLATSLISGNEFLINALKGMQMLSGSISITHVEDVCRAHVFLAEKESASGRYICSAVNTSVPELAXFLNKRYPDFKVPTDFGDSXLQPKLIISSEKLISERFSFKYGIEEIYDQTVEILKSKGLLK

HMMPanther: PTHR10366
2-221 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

ARAKTVKRVVLTSSAAAVSINTLDGTDLVMTEKDWTDIEFLSSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPSLMTGPSLTPIVPSSIGLATSLISGNEFLINALKGMQMLSGSISITHVEDVCRAHVFLAEKESASGRYICSAVNTSVPELAXFLNKRYPDFKVPTDFGDSXLQPKLIISSEKLISERFSFKYGIEEIYDQTVEILKSKGLLK

Gene3D: G3DSA:3.40.50.720
IPR016040
4-129 no description
NAD(P)-binding domain

AKTVKRVVLTSSAAAVSINTLDGTDLVMTEKDWTDIEFLSSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPSLMTGPSLTPIVPSSIGLATSLISGNEFLINALKGMQMLSGSISITHVED






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox