PRGDB00068437 (Ghi.8435)

From PRG Wiki
Jump to: navigation, search
Ghi.8435
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164300099 (ES834789)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Gossypium hirsutum

Comment?

UFL_002_04 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

AGATCAGTCCATTTACAAGGATGCTTGTTTTTGAATATGCATCAAATGGAACACTTCACGAGCATTTGCATTATGGAGAAGGATCCCAACTATCTTGGACAAGACGTATGAGAATTATTCTCGGCATTGCTCGAGGACTCAAGTATCTTCATGCAGAACTTGAGCCACCATTCACTATATCAGAGTTAAACTCTAGTGCTGTGTATCTTACAGAGGATTTTTCCCCCAAGTTGGTTGATTTTGAAAGTTGGAAGACTATTATTGCTAGATCAGAAAAGAACTCTGGTTCTATTGGCAGCAATGGAGCCATGTGTCTACTTCCCAGTTCTGTGGAGAATCGTCATCTTGATATCCAGGGAAACATACATGCTTTTGGCATACTTCTACTCGAGATAATCAGTGGTAGGCCTCCATTTTGCAAGGACAGGGGGTCTTTGATAGATTGGGCCAAGGACTATCTTGAACTACCGGATGTAATGTCTCATATTGTGGACCCTGAACTAAAGCATTTCACGTACGATGACCTCAAACTCATCTGCGAAATCATAAGCCTTTGCATTCATCCAGACATTTCGAGACGGCCATCCATGCAGGAAATAAGCCTCATGCTCGAGAGCAGCATTGACACGTCGGTATCTATTGAGCTCAAGTCATCTTCTTTGGCATGGGCTGAACTTGCTCTTTCATCATGATTAATTGAAGCTGCTAACCACACTATTAGATCAAAATACATACAGTTTTACCCttttttttCCCTTCCTTTCAATCTTTGTAAATGCTGTACGCCAAAAGAAACATTTGGGGTTCATCTAGTTACTGAAAAATCCCACTTCATTTGTATACCTTGGATGTTTTCAGAATTTTTTCTTTTCTGAAAATAACAATACAACTGGGTTTATTCCTTTTCCCaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ghi.8435 translated coding region predicted by ESTScan from UniGene Ghi.8435

XISPFTRMLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEISLMLESSIDTSVSIELKSSSLAWAELALSS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-208 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XISPFTRMLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEISLMLESSI

HMMPanther: PTHR24420:SF812
4-208 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

PFTRMLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEISLMLESSI

HMMPanther: PTHR24420
4-208 FAMILY NOT NAMED,FAMILY NOT NAMED

PFTRMLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEISLMLESSI

superfamily: SSF56112
IPR011009
6-212 Protein kinase-like (PK-like)
Protein kinase-like domain

TRMLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEISLMLESSIDTSV

Gene3D: G3DSA:1.10.510.10
8-201 no description

MLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEIS

HMMPfam: PF00069
IPR017442
8-200 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

MLVFEYASNGTLHEHLHYGEGSQLSWTRRMRIILGIARGLKYLHAELEPPFTISELNSSAVYLTEDFSPKLVDFESWKTIIARSEKNSGSIGSNGAMCLLPSSVENRHLDIQGNIHAFGILLLEIISGRPPFCKDRGSLIDWAKDYLELPDVMSHIVDPELKHFTYDDLKLICEIISLCIHPDISRRPSMQEI

Seg: seg
218-230 seg

SSSLAWAELALSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox