PRGDB00068442 (Ghi.8787)

From PRG Wiki
Jump to: navigation, search
Ghi.8787
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164262188 (ES807200)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

UFL_593_05 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGAGCGTGCAGGATCACTTGTCAAGTCGATTTCAAGCAACTCTTCCTTGGGCCACAAGAATAAAAATTGCCCAGGATGCCGCTCGTGGCTTAACATACCTCCATGAAGGAATGGATTTTCAGGTTCCCTTTTACTTCTCAGTAGATACGGCTTTCCTGAAATCAATAACCTTGAAGCCTCGTTTTACAATTGAAACCTGGAATGACCTCATTATTGCTTTTAGGCTAAAGAATTTTTGGTTTATGGTTGCTACAGATTATCTTCAGAGATTTCAAGTCTTCAAACATACTGTTGGATGAGCATTGGAACGCAAAGCTCTCGGATTTTGGGTTGGCCAGGCTAGGGCCTTCTGATGGATTAAGCCATGTTTCGACTGCGGTAGGTTCGAAGTTGCTATAAACTATGTTGCTCTGACTtttcattttcttttatttgaacatttccagatttttattcctactctggtccagttttttcAAATATTTCCGAATTTTCAGAAGCATGCTTGTTTTATGGATATTATCAAATTGTCCCGGGTTTGAGCAGGTTGTAGGAACCATTGGATATGCAGCTCCTGAATACATTCAAACCGGGCGCCTCACGGCAAAAAGTGATGTGTGGAGCTATGGAGTTTTTCTTTACGAGCTCATAACAGGTAGGCGTCCCTTGGATCGGAATCGTCCCAAGTCTGAACAAAAACTCTTGGAATGGGTCAGGCCACACCTCTCCGATATGAAGAAGTTCAGGCTGATCTTGGACCCGAGGCTCGAAGGCAAGTATTCCCTCAAGTCTGCTCGTAAACTCGCAGCGGTAGCCAATAAATGCTTGGGTTCGGCAGGCTAAACAACGCCCAAAAAATGAGTGAAGTTCTACAGATGGTGGGATGAAATTGTGGAAACTGCAGATATGCTAAACCCCTCAACCCGGCTACGGGGAGTTCAATTTCAAAAACATGGTTTCAGAAACTATCCaaaaagaaaagcgaatggaaaaaaaaGGTTCATTGGATCTGATAAACAACGACAAAAAAATGTTTCGTTTGGCGAAAATGGGAAACCCAAAAATGGGGAAGAACTACATAAGCAAATTATCAATTTCCAAGTTTTGTTTAACTTTCCTGTTTTTCGTATaaaaaaaaaaaTTTGGAAAGGGGTTTTAGAAGGGAAAAAAATCAACCTGCGCAAGGAATTTTATGTTAAAAGGGGGttttttgcttttttttggaggaaaaggttttttataataataaattaatttttttaatatatttagtagtggtttttttttataaagagagagaaagaaagaaaaaa


Protein sequences

Name Description Sequence
Ghi.8787 translated coding region predicted by ESTScan from UniGene Ghi.8787

XSVQDHLSSRFQATLPWATRIKIAQDAARGLTYLHEGMDFQVPFYFSVDTAFLKSITLKPRFTIETWNDLIIAFRLKNFWFMVATDYLQRFQVFKHTVGXALERKALGFWVGQARAFXWIKPCFDCGRFEVAINYVALTFHFLLFEHFQIFIPTLVQFFQIFPNFQKHACFMDIIKCPGFEQVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCLGSAG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-280 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XSVQDHLSSRFQATLPWATRIKIAQDAARGLTYLHEGMDFQVPFYFSVDTAFLKSITLKPRFTIETWNDLIIAFRLKNFWFMVATDYLQRFQVFKHTVGXALERKALGFWVGQARAFXWIKPCFDCGRFEVAINYVALTFHFLLFEHFQIFIPTLVQFFQIFPNFQKHACFMDIIKCPGFEQVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCLGSAG

HMMPanther: PTHR24420:SF641
2-276 SUBFAMILY NOT NAMED

SVQDHLSSRFQATLPWATRIKIAQDAARGLTYLHEGMDFQVPFYFSVDTAFLKSITLKPRFTIETWNDLIIAFRLKNFWFMVATDYLQRFQVFKHTVGXALERKALGFWVGQARAFXWIKPCFDCGRFEVAINYVALTFHFLLFEHFQIFIPTLVQFFQIFPNFQKHACFMDIIKCPGFEQVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCL

HMMPanther: PTHR24420
2-276 FAMILY NOT NAMED,FAMILY NOT NAMED

SVQDHLSSRFQATLPWATRIKIAQDAARGLTYLHEGMDFQVPFYFSVDTAFLKSITLKPRFTIETWNDLIIAFRLKNFWFMVATDYLQRFQVFKHTVGXALERKALGFWVGQARAFXWIKPCFDCGRFEVAINYVALTFHFLLFEHFQIFIPTLVQFFQIFPNFQKHACFMDIIKCPGFEQVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCL

superfamily: SSF56112
IPR011009
2-36 Protein kinase-like (PK-like)
Protein kinase-like domain

SVQDHLSSRFQATLPWATRIKIAQDAARGLTYLHE

Gene3D: G3DSA:1.10.510.10
180-276 no description

FEQVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCL

HMMPfam: PF00069
IPR017442
180-236 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FEQVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLE

superfamily: SSF56112
IPR011009
183-276 Protein kinase-like (PK-like)
Protein kinase-like domain

VVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox