PRGDB00068445 (Ghi.8869)

From PRG Wiki
Jump to: navigation, search
Ghi.8869
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 109873140 (DW502115)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

GH_TMIRS_063_C09_F Cotton Normalized Library dT primed Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

TGGACAACCGAATGAAGATAGCATTAAGCACGGCTAGGGGCTTAGAACACCTCCATGTTTCAGCAAAACTGGTACATGGCAACATTAAATCCTCCAACATTCTTTTACGATCAGACCACAAAGCTTGTATCTCCGACTTTGGTCTCAATCCACTCTTTGGCAACACCACTCCTCCTAGCCGTGTTGCAGGCTATCGAGCACCTGAAATACTTGAAACCTGCAAAGTTACGTTCGAGTCCGATGTTTACAGCTTTGGAGTGTTACTACTAGAATTATTAACAGGCAAAGCACCTAATCAAGCATCTTTAGGGGAAGAGGGGATCGATCTCCCTCGTTGGGTCCAATCTGTGGTTCGAGAGGAATGGACCGCAGAGGTTTTTGATGTGGAGTTAATGAGATATCATAGAATTGAAGAGGAAATGGTGCAGCTGTTACAAATTGCGATGACTTGCGTATCAACTGTGCCCGATCAAAGACCCGCCATGCAAGAAGTGGTACGAATGATTGAAGATATGAATCGAGGTGAAACTGACGATGGATTACGACAATCGTCTGATGATCGGTCAAAAGGATCCGACGGTCATACTCCTGCGGAATCTAGAACCCCACCGAGATCCTCCACACCGTAGCATAATGTGCACAAAGTGGTCATTTGCTCCAAATTGTGATctttgtttctatttttggggggttttagtttttctcttaattgtcctttgaaattattttttaagtagattttttgggggggggAGATTTGAGTTGTTTTTGGTGGTTGGATAG


Protein sequences

Name Description Sequence
Ghi.8869 translated coding region predicted by ESTScan from UniGene Ghi.8869

XDNRMKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDDRSKGSDGHTPAESRTPPRSSTP

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-172 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XDNRMKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDM

HMMPanther: PTHR24420:SF779
2-209 SUBFAMILY NOT NAMED

DNRMKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDDRSKGSDGHTPAESRTPPRSSTP

HMMPanther: PTHR24420
2-209 FAMILY NOT NAMED,FAMILY NOT NAMED

DNRMKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDDRSKGSDGHTPAESRTPPRSSTP

Gene3D: G3DSA:1.10.510.10
3-200 no description

NRMKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDDRSKGSDGHTPAES

superfamily: SSF56112
IPR011009
4-169 Protein kinase-like (PK-like)
Protein kinase-like domain

RMKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMI

HMMPfam: PF00069
IPR000719
5-167 Pkinase,Ser-thr
Protein kinase, catalytic domain

MKIALSTARGLEHLHVSAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHRIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox