PRGDB00068847 (Gma.8534)

From PRG Wiki
Jump to: navigation, search
Gma.8534
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 6573166 (AF202182)
Gene Class Unknown
Domain Type
Gene Species Glycine max

Comment?

Glycine max 2'-hydroxy isoflavone

DNA Sequence

GAATTCGGCACGAGCAAAGGAAGAGTGTGTGTTACAGGAGGTACAGGTTTTATTGGTTCATGGATAATCAAGAGGCTCCTTGAAGATGGTTACTCTGTTAACACCACTGTGAGACCCGATCCAGAACACAGGAAAGATGTTAGCTTTCTTACTAGCTTACCTAGAGCATCCCAAAGGCTACAAATTCTCAGTGCTGATCTCAGCAATCCAGAAAGTTTTATTGCTTCCATTGAAGGGTGTATGGGAGTTTTCCATGTTGCTACACCAGTCGACTTTGAATTAAGAGAACCAGAAGAAGTAGTGACCAAAAGATCCATTGAAGGTGCACTTGGCATTTTGAAGGCATGCCTCAATTCCAAGACAGTGAAGCGAGTTGTTTACACCTCTAGTGCCTCTGCTGTCGATAACAATAAAGAAGAAATTATGGATGAAAGCTCATGGAACGACGTGGATTATCTTAGATCTTCAAAGCCATTTGGTTGGTCATATTCTGTTTCAAAGACATTGACAGAAAAGGCAGTGCTTGAATTTGGAGAACAAAATGGATTGGATGTTGTCACACTAATTCCAACTCTTGTTTTTGGACCCTTCATTTGTCCAAAGCTTCCAAGCTCAGTTCGTAATTCATTGGATTTTATACTTGGAGAAAAGGGTACATTTGGTGTCGTTCTACAGACAGATATGGTGCATGTGGATGACGTGGCTAGGGCACATATATTTCTGCTTGAACATCCTAATCCAAAAGGGAGGTATATTTGTTCACAATGTTCAGTAACTTATGAAAGGATCTCCAAACTTGTTTCTGCCAAATATCCAGAATTTCAACCACCACCTGTAGAGTCTCTGAATCATATTGAAGGTACAAAAGGATCATATTTGTCATCAAAGAAGCTGATAGATGCAGGATTTGTGTACAAGTATGGACTTGAGGAAATGGTTGATGATGCCATCCAATGCTGCAAAGAAAAGGGTTACCTGTGAAGTAGCTAGCGGTGTACCCTTTTTTATGTTATTATAGGATGAGGATGGCTATATATCCATACAATAAGACAATAATTAACTACTTTGATAAATGGTTGTTCATGCTACCAATTGAATGCTTTTGCCTTTTGGAATTGGATTGCAGTTGGCAATGGAAACTAACTATTTCAGTTGGTATTTAAACCTTTAAATAACACGTGCTGTGTTAGTTGTGACAATATATACCAAAGGTCCAATTCAGTTGGTATTTAAACCA


Protein sequences

Name Description Sequence
Gma.8534 translated coding region predicted by ESTScan from UniGene Gma.8534

EFGTSKGRVCVTGGTGFIGSWIIKRLLEDGYSVNTTVRPDPEHRKDVSFLTSLPRASQRLQILSADLSNPESFIASIEGCMGVFHVATPVDFELREPEEVVTKRSIEGALGILKACLNSKTVKRVVYTSSASAVDNNKEEIMDESSWNDVDYLRSSKPFGWSYSVSKTLTEKAVLEFGEQNGLDVVTLIPTLVFGPFICPKLPSSVRNSLDFILGEKGTFGVVLQTDMVHVDDVARAHIFLLEHPNPKGRYICSQCSVTYERISKLVSAKYPEFQPPPVESLNHIEGTKGSYLSSKKLIDAGFVYKYGLEEMVDDAIQCCKEKGYL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
3-326 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

GTSKGRVCVTGGTGFIGSWIIKRLLEDGYSVNTTVRPDPEHRKDVSFLTSLPRASQRLQILSADLSNPESFIASIEGCMGVFHVATPVDFELREPEEVVTKRSIEGALGILKACLNSKTVKRVVYTSSASAVDNNKEEIMDESSWNDVDYLRSSKPFGWSYSVSKTLTEKAVLEFGEQNGLDVVTLIPTLVFGPFICPKLPSSVRNSLDFILGEKGTFGVVLQTDMVHVDDVARAHIFLLEHPNPKGRYICSQCSVTYERISKLVSAKYPEFQPPPVESLNHIEGTKGSYLSSKKLIDAGFVYKYGLEEMVDDAIQCCKEKGYL

HMMPanther: PTHR10366
3-326 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

GTSKGRVCVTGGTGFIGSWIIKRLLEDGYSVNTTVRPDPEHRKDVSFLTSLPRASQRLQILSADLSNPESFIASIEGCMGVFHVATPVDFELREPEEVVTKRSIEGALGILKACLNSKTVKRVVYTSSASAVDNNKEEIMDESSWNDVDYLRSSKPFGWSYSVSKTLTEKAVLEFGEQNGLDVVTLIPTLVFGPFICPKLPSSVRNSLDFILGEKGTFGVVLQTDMVHVDDVARAHIFLLEHPNPKGRYICSQCSVTYERISKLVSAKYPEFQPPPVESLNHIEGTKGSYLSSKKLIDAGFVYKYGLEEMVDDAIQCCKEKGYL

superfamily: SSF51735
7-322 NAD(P)-bd

GRVCVTGGTGFIGSWIIKRLLEDGYSVNTTVRPDPEHRKDVSFLTSLPRASQRLQILSADLSNPESFIASIEGCMGVFHVATPVDFELREPEEVVTKRSIEGALGILKACLNSKTVKRVVYTSSASAVDNNKEEIMDESSWNDVDYLRSSKPFGWSYSVSKTLTEKAVLEFGEQNGLDVVTLIPTLVFGPFICPKLPSSVRNSLDFILGEKGTFGVVLQTDMVHVDDVARAHIFLLEHPNPKGRYICSQCSVTYERISKLVSAKYPEFQPPPVESLNHIEGTKGSYLSSKKLIDAGFVYKYGLEEMVDDAIQCCKE

Gene3D: G3DSA:3.40.50.720
IPR016040
8-234 NAD(P)-bd
NAD(P)-binding domain

RVCVTGGTGFIGSWIIKRLLEDGYSVNTTVRPDPEHRKDVSFLTSLPRASQRLQILSADLSNPESFIASIEGCMGVFHVATPVDFELREPEEVVTKRSIEGALGILKACLNSKTVKRVVYTSSASAVDNNKEEIMDESSWNDVDYLRSSKPFGWSYSVSKTLTEKAVLEFGEQNGLDVVTLIPTLVFGPFICPKLPSSVRNSLDFILGEKGTFGVVLQTDMVHVDDV

HMMPfam: PF01370
IPR001509
9-250 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGTGFIGSWIIKRLLEDGYSVNTTVRPDPEHRKDVSFLTSLPRASQRLQILSADLSNPESFIASIEGCMGVFHVATPVDFELREPEEVVTKRSIEGALGILKACLNSKTVKRVVYTSSASAVDNNKEEIMDESSWNDVDYLRSSKPFGWSYSVSKTLTEKAVLEFGEQNGLDVVTLIPTLVFGPFICPKLPSSVRNSLDFILGEKGTFGVVLQTDMVHVDDVARAHIFLLEHPNPKGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox