PRGDB00068862 (Gma.9607)

From PRG Wiki
Jump to: navigation, search
Gma.9607
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 26518501 (AY163905)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max receptor-like kinase RHG4 (Rhg4) mRNA, complete cds

DNA Sequence

ATGTCGAATTTTCTCAAATCCCTCACTCCACCGCCCTCGGGCTGGTCTGAAACAACCCCATTCTGCCAATGGAAGGGTATCCAATGCGATTCATCCAGCCACGTGACCAGCATAAGCCTCGCTTCGCAgtccctcaccggaacactcccctcggatctcaattccctctctcaactccgcactctctccctcCAGGACAATTCCCTCACCGGCACCCTCCCTTCTCTCTCCAACCTTTCTTTCCTCCAAACCGTCTACTTCAACCGCAACAACTTCTCCTCCGTGTCCCCCACCGCCTTCGCCTCCCTAACCTCCCTCCAAACCCTCAGCCTCGGCTCCAACCCTGCTCTCCAACCCTGGTCCTTCCCCACCGACCTCACTTCCTCCTCTAACCTAATCGACCTCGACCTCGCCACCGTATCCCTCACCGGTCCCTTGCCGGACATTTTCGACAAATTCCCTTCCCTTCAACACCTTCGCCTCTCTTACAACAACCTCACCGGCAATTTACCCTCCTCTTTCTCCGCCGCCAACAATCTCGAAACGCTCTGGCTCAACAACCAGGCCGCCGGCTTGTCCGGTACCCTCCTCGTCCTCTCCAACATGTCTGCATTAAACCAGTCCTGGCTCAATAAGAACCAGTTCACCGGTTCCATTCCGGATTTATCGCAATGCACGGCTTTGTCTGACTTGCAGCTCAGGGATAACCAGTTAACTGGTGTGGTTCCCGCTTCATTGACAAGTCTTCCTAGTTTGAAGAAAGTTTCTCTGGATAATAATGAGCTTCAGGGGCCTGTGCCCGTGTTTGGGAAAGGTGTGAATGTTACTCTCGATGGGATTAATAGTTTTTGTCTTGATACTCCTGGGAATTGTGATCCCAGGGTGATGGTTTTGCTGCAGATTGCCGAGGCATTCGGGTATCCGATTCGGTTGGCAGAGTCGTGGAAGGGGAATGATCCGTGTGATGGTTGGAACTATGTTGTGTGTGCTGCCGGAAAGATTATTACTGTCAATTTCGAGAAACAGGGTTTGCAGGGTACCATCTCCCCTGCATTTGCCAATTTGACTGACTTGAGGACTTTGTTTCTCAATGGCAATAATTTGATCGGTTCTATACCTGATAGTTTGATCACTTTGCCTCAGCTTCAGACTCTTGATGTGTCTGACAACAACCTCTCTGGATTGGTTCCTAAGTTCCCACCAAAGGTGAAGTTGGTGACTGCGGGAAATGCTTTGCTTGGGAAACCCCTTAGTCCTGGAGGTGGACCAAGTGGAACTACTCCTTCTGGGTCTTCGACCGGTGGAAGTGGTGGTGAATCCTCAAAGGGTAATTCTTCGGTGTCGCCAggttggattgctggtatagttgttattgtgttgttttttattgcagtggtgttgtttgtgtCTTGGAAGTGTTTTGTCAACAAGCTGCAGGGGAAGTTCAGTAGGGTTAAAGGTCATGAAAATGGGAAAGGAGGCTTTAAACTTGATGCTGTCCATGTTTCTAATGGATATGGTGGTGTTCCAGTTGAGTTGCAAAGCCAGAGCAGTGGTGATCGCAGTGACCTTCATGCTTTAGATGGTCCAACATTTTCTATCCAAGTTCTTCAACAAGTGACGAATAATTTCAGCGAGGAGAACATTTTAGGCAGGGGAGGGTTTGGAGTAGTTTATAAGGGGCAGTTGCATGATGGAACAAAAATTGCTGTCAAGAGGATGGAATCTGTTGCAATGGGTAACAAAGGACTGAAAGAGTTCGAAGCAGAGATTGCAGTTCTTAGTAAAGTTAGGCATAGACATTTGGTTGCTCTTTTAGGGTATTGCATCAATGGCATTGAAAGGCTTTTGGTCTATGAGTATATGCCTCAAGGTACGTTAACACAGCACCTGTTTGAATGGCAGGAGCAAGGCTATGTTCCTTTGACTTGGAAACAAAGGGTAGTAATAGCTTTGGATGTAGCGCGGGGGGTGGAATACTTGCACAGTTTAGCTCAGCAAAGCTTCATTCATAGAGACTTAAAACCCTCAAACATACTACTAGGTGATGACATGAGAGCAAAGGTTGCTGATTTTGGTTTGGTTAAAAATGCACCAGATGGGAAGTATTCTGTTGAGACACGGTTGGCTGGAACATTTGGATATCTTGCACCTGAGTATGCAGCTACTGGAAGAGTGACAACCAAAGTGGATATTTATGCATTTGGAATAGTTTTGATGGAACTTATCACCGGTAGAAAGGCATTGGATGATACTGTGCCTGATGAAAGGTCTCACTTGGTTACATGGTTCCGTAGGGTACTCATTAACAAGGAAAACATTCCAAAGGCAATTGATCAAACTCTCAATCCTGACGAGGAAACCATGGAGAGCATATATAAAGTGGCTGAGCTGGCAGGCCATTGCACTGCTCGTGAACCATACCAAAGGCCGGATATGGGCCATGCAGTGAACGTCTTGGTTCCTCTTGTGGAGCAATGGAAACCTTCTAGCCACGACGAAGAAGAGGACGGCTCTGGTGGTGACCTGCAAATGAGCCTTCCTCAAGCTCTACGAAGGTGGCAAGCCAACGAAGGCACTTCCTCAATATTTAATGACATTTCCATCTCACAAACCCAATCAAGCATCTCCTCTAAACCTGTTGGATTTGCAGACACCTTTGATTCAATGGATTGCCGTTAA


Protein sequences

Name Description Sequence
Gma.9607 translated coding region predicted by ESTScan from UniGene Gma.9607

MSNFLKSLTPPPSGWSETTPFCQWKGIQCDSSSHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVCAAGKIITVNFEKQGLQGTISPAFANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNKLQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPLVEQWKPSSHDEEEDGSGGDLQMSLPQALRRWQANEGTSSIFNDISISQTQSSISSKPVGFADTFDSMDCR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF467
1-885 PTHR24420:SF467,SUBFAMILY NOT NAMED

MSNFLKSLTPPPSGWSETTPFCQWKGIQCDSSSHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVCAAGKIITVNFEKQGLQGTISPAFANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNKLQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPLVEQWKPSSHDEEEDGSGGDLQMSLPQALRRWQANEGTSSIFNDISISQTQSSISSKPVGFAD

HMMPanther: PTHR24420
1-885 PTHR24420,FAMILY NOT NAMED

MSNFLKSLTPPPSGWSETTPFCQWKGIQCDSSSHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVCAAGKIITVNFEKQGLQGTISPAFANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNKLQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPLVEQWKPSSHDEEEDGSGGDLQMSLPQALRRWQANEGTSSIFNDISISQTQSSISSKPVGFAD

superfamily: SSF52058
3-407 SSF52058,LRR

NFLKSLTPPPSGWSETTPFCQWKGIQCDSSSHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVCAAGKIITVNFEKQGLQGTISPAFANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVT

HMMPfam: PF08263
IPR013210
4-30 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

FLKSLTPPPSGWSETTPFCQWKGIQCD

Gene3D: G3DSA:3.80.10.10
8-271 G3DSA:3.80.10.10

LTPPPSGWSETTPFCQWKGIQCDSSSHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGK

HMMPfam: PF13855
57-114 LRR_8,Leucine rich repeat

SQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSN

ProfileScan: PS51450
IPR001611
58-80 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRTLSLQDNSLTGTLPSLSNLS

ProfileScan: PS51450
IPR001611
81-102 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLQTVYFNRNNFSSVSPTAFAS

HMMPfam: PF00560
IPR001611
155-175 LRR_1
Leucine-rich repeat

SLQHLRLSYNNLTGNLPSSFS

ProfileScan: PS51450
IPR001611
155-177 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQHLRLSYNNLTGNLPSSFSAA

ProfileScan: PS51450
IPR001611
204-226 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALNQSWLNKNQFTGSIPDLSQCT

ProfileScan: PS51450
IPR001611
227-250 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALSDLQLRDNQLTGVVPASLTSLP

Gene3D: G3DSA:3.80.10.10
296-398 G3DSA:3.80.10.10

MVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVCAAGKIITVNFEKQGLQGTISPAFANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPK

HMMPfam: PF08263
IPR013210
297-329 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

VLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVC

HMMPfam: PF13855
350-392 LRR_8,Leucine rich repeat

PAFANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNL

ProfileScan: PS51450
IPR001611
357-380 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRTLFLNGNNLIGSIPDSLITLP

ProfileScan: PS51450
IPR001611
381-402 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQTLDVSDNNLSGLVPKFPPK

superfamily: SSF56112
IPR011009
516-829 Kinase_like
Protein kinase-like domain

QSSGDRSDLHALDGPTFSIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPLVEQWKP

Gene3D: G3DSA:3.30.200.20
531-607 G3DSA:3.30.200.20

TFSIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLG

ProfileScan: PS50011
IPR000719
544-824 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPLV

HMMPfam: PF00069
IPR017442
546-817 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAV

PatternScan: PS00107
IPR017441
550-572 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGVVYKGQLHDGTKIAVK

Gene3D: G3DSA:1.10.510.10
608-822 G3DSA:1.10.510.10

YCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTWFRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVP

PatternScan: PS00108
IPR008271
669-681 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox