PRGDB00068863 (Gma.9637)

From PRG Wiki
Jump to: navigation, search
Gma.9637
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 26986722 (AF529302)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max polygalacturonase inhibitor protein mRNA, complete cds

DNA Sequence

ATGATCATGGTCTTGCTCATAGTCCTATACCTTTCTGCACCAGCACTCTCAAAACTGTGCAACCAAGACAAGCAAGTCCTCCTCCAAATCAAGAAAGAGCTTGGCAACCCAACCAAACTCTCTTCATGGCTCCCAACCACTGACTATTGCGACACCATTTGGGAAGGTGTCGCTTGTGTCACCGACAGCAACAACCAGACATGCCGCGTCGACATCCTCTACCTctcccaccttaacctccccaaaccctaccctattcccccctccataggcaaccttccctACTTGAATTATCTTTACCTCATTGACACAAACTTCTTCGGCGCAATCCCCTCTTCCATCGCTAATCTCACCAACCTCAATTATCTCAACATCACATACACCAATGTCTCTGGCACAATACCAGATTTCTTGTCCCATATCAAAACCCTAGTCAGCATTGACTTCTCTTACAACAACCTCTCCGGCAACCTCCCTGCCTCGCTCTCCTCGCTCCCCAACCTCGGCGAAATGATCTTCACCGGCAACCGAATCTCCGGCGCCATCCCCGACTCCTTCGGCTCCTTCTCCGAGGAGCTCATATTGATGAGGCTCTCCCGCAACCGCCTCACCGGGAAGATTCCGGCGACGCTGGCGAAGCTGAATCTGCGGTTCTTGGACTTGTCTCGGAACATGCTGGAGGGTGACGCGTCGGTGCTGTTTGGGTCGGAGAAAGACACGGTGCAGATAAATCTGGGGAAGAACAATCTTGCTTTTGACCTGGGGAAAGTGGAGTTTTCAGAGATATTGGCCATCTTGGATCTTAGGCATAACCGTATCTATGGAACGTTACCTCAGGGACTTACGGCGCTTAAGCATCTGACTAAGCTGAACGTGAGTAACAACAATCTGTGTGGTGAGATTCCGCAAGGTGGCAACTTGCAGAGAATTAAGGTGAATTCCTATGCTCACAACAAGTGCTTGTGTGGCTCTNCTCTTCCCGCTTGCACTTTGGTTAATTAACGTTGTTTTATCATTCAACTCACAAGTCGCAGTTAATCCATGTGTGACTTATGTTTTAATTAATGTCATCAATAATAATGCGTAATCTAACTaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Gma.9637 translated coding region predicted by ESTScan from UniGene Gma.9637

MIMVLLIVLYLSAPALSKLCNQDKQVLLQIKKELGNPTKLSSWLPTTDYCDTIWEGVACVTDSNNQTCRVDILYLSHLNLPKPYPIPPSIGNLPYLNYLYLIDTNFFGAIPSSIANLTNLNYLNITYTNVSGTIPDFLSHIKTLVSIDFSYNNLSGNLPASLSSLPNLGEMIFTGNRISGAIPDSFGSFSEELILMRLSRNRLTGKIPATLAKLNLRFLDLSRNMLEGDASVLFGSEKDTVQINLGKNNLAFDLGKVEFSEILAILDLRHNRIYGTLPQGLTALKHLTKLNVSNNNLCGEIPQGGNLQRIKVNSYAHNKCLCGSXLPACTLVN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
5-324 PTHR24420,FAMILY NOT NAMED

LLIVLYLSAPALSKLCNQDKQVLLQIKKELGNPTKLSSWLPTTDYCDTIWEGVACVTDSNNQTCRVDILYLSHLNLPKPYPIPPSIGNLPYLNYLYLIDTNFFGAIPSSIANLTNLNYLNITYTNVSGTIPDFLSHIKTLVSIDFSYNNLSGNLPASLSSLPNLGEMIFTGNRISGAIPDSFGSFSEELILMRLSRNRLTGKIPATLAKLNLRFLDLSRNMLEGDASVLFGSEKDTVQINLGKNNLAFDLGKVEFSEILAILDLRHNRIYGTLPQGLTALKHLTKLNVSNNNLCGEIPQGGNLQRIKVNSYAHNKCLCGS

superfamily: SSF52058
17-330 SSF52058,LRR

SKLCNQDKQVLLQIKKELGNPTKLSSWLPTTDYCDTIWEGVACVTDSNNQTCRVDILYLSHLNLPKPYPIPPSIGNLPYLNYLYLIDTNFFGAIPSSIANLTNLNYLNITYTNVSGTIPDFLSHIKTLVSIDFSYNNLSGNLPASLSSLPNLGEMIFTGNRISGAIPDSFGSFSEELILMRLSRNRLTGKIPATLAKLNLRFLDLSRNMLEGDASVLFGSEKDTVQINLGKNNLAFDLGKVEFSEILAILDLRHNRIYGTLPQGLTALKHLTKLNVSNNNLCGEIPQGGNLQRIKVNSYAHNKCLCGSXLPACT

Gene3D: G3DSA:3.80.10.10
21-324 G3DSA:3.80.10.10

NQDKQVLLQIKKELGNPTKLSSWLPTTDYCDTIWEGVACVTDSNNQTCRVDILYLSHLNLPKPYPIPPSIGNLPYLNYLYLIDTNFFGAIPSSIANLTNLNYLNITYTNVSGTIPDFLSHIKTLVSIDFSYNNLSGNLPASLSSLPNLGEMIFTGNRISGAIPDSFGSFSEELILMRLSRNRLTGKIPATLAKLNLRFLDLSRNMLEGDASVLFGSEKDTVQINLGKNNLAFDLGKVEFSEILAILDLRHNRIYGTLPQGLTALKHLTKLNVSNNNLCGEIPQGGNLQRIKVNSYAHNKCLCGS

HMMPfam: PF08263
IPR013210
21-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NQDKQVLLQIKKELGNPTKLSSWLPTTDYCDTIWEGVAC

HMMPfam: PF00560
IPR001611
144-165 LRR_1
Leucine-rich repeat

LVSIDFSYNNLSGNLPASLSSL

HMMPfam: PF00560
IPR001611
286-303 LRR_1
Leucine-rich repeat

HLTKLNVSNNNLCGEIPQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox