PRGDB00068874 (Gma.10849)

From PRG Wiki
Jump to: navigation, search
Gma.10849
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 210143591 (AK286373)
Gene Class Unknown
Domain Type
Gene Species Glycine max

Comment?

Glycine max cDNA, clone: GMFL01-26-O23

DNA Sequence

GAGCTCTCACTTCCTTTTGCCACATTACACAAGAACTCTCCAAGGATCCTCCTTCCCACGAAATTCTTTGGTGGGAAAATCCAAGAAGAGGGTGGAATTTCAAGCCAGGGAAGATGGATTATTTCAATGCACCAGGAAGAAACCATCTCTTTGTTCCGGGGCCGGTTAACATCCCGGACCAGATCATTCGGGCCATGAACAGAAACAATGAGGACTACCGTTCTCCAGCAATTCCAGCTATGACCAAAACACTGCTTGAGGATGTCAAGAAGATTTTCAAGACCATAACTGGAATCCCATTTCTCATCCCTACAACTGGTACTGGTGCTTGGGAGAGTGCTCTCACAAACACACTGTCTCCTGGGGATCGAATTGTATCTTTCCTGATTGGCCAATTCAGCTTGCTTTGGATTGATCAGCAGCAACGCCTGAAATTCAATGTTGATGTTGTAGAGAGTGAATGGGGCCAGGGTGCTAAGCTTGATGTTCTGGAATCAAAGATTGCTTCAGATACTTCACACACTATTAAGGCAATTTGCATTGTCCACAATGAGACTGCAACTGGGGTCACCAATGACTTGGCCAAAGTGAGACAAATTCTCGATTCCTACCGGCATCCAGCCCTCCTTATTGTTGATGGAGTGTCTTCTATTTGTGCTCTTGATTTCCGCATGGATGAATGGGGAGTTGATGTGGCAATAACTGGCTCTCAGAAGGCCCTTTCCCTTCCCACTGGGATAGGTATTGTGGTTGCAGGCCCTAGAGCTATTGAGGCCTCAAAACATGCTAAATCACTTCGAGTTTTCTTTGACTGGAAAGACTACCTGAAATTCTACCAGCTAGGAACGTATTGGCCATACACTCCTTCCATACATTTGCTGTATGGTCTGAGAGCTGCTCTTGATCTGATTTTTGAGGAAGGACTTGAAAATGTGATTGCAAGACACAGTCGTTTAGGCAAAGCAACCAGACTTGCTGTAGAGGCATGGGGTTTGAAGAATTGCACCCAAAAGGAAGAGTGGTACAGTGACACTGTGACTGCTGTTCTTGTTCCTGCTTACATTGATAGTACTGAAATAGTTAGAAGGGCATGGAAGAGATACAATTTGAGCTTAGGTCTTGGACTGAACAAAGTTGCTGGGAAGGTTTTCAGAATTGGACATCTTGGCAACTTGAATGAGTTGCAACTGTTGGGATGTCTAGCTGGTGTGGAGATGATACTGAAAGATGTGGGCTATCCTGTAAAGCTTGGAAGTGGAGTTGCTGCTGCCAGTGCATACTTACAGGACACTATTCCTATGATCCCTTCCAGGATTTGAGTCACAAGTCATTCTTGTCTTTACTTCCTTTTTTCTGCTCTTTCGGAAATTCTGTAAAATATATATTACCCTCTTTTACACTCCTTTGAAGATGAACATACACTCTACTTTCAGCTTTAATGCATTGCTTCTTTTATTGTCCTGTATATCAAAAATCATTGCATCTTATGATCTTATTTGTCACTGTGTTATGGTCATCAAATTCATCAGCAGCAGGGTTATTGTATTGTATATGGATAAAGAGAAATGCTAGTAACATGCACATTCCCTCCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Gma.10849 translated coding region predicted by ESTScan from UniGene Gma.10849

XALTSFCHITQELSKDPPSHEILWWENPRRGWNFKPGKMDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITGIPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
39-439 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITGIPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI

HMMPanther: PTHR21152
39-439 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITGIPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI

superfamily: SSF53383
IPR015424
45-415 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITGIPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPV

HMMPfam: PF00266
IPR000192
50-361 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITGIPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIV

Gene3D: G3DSA:3.40.640.10
IPR015421
60-295 no description
Pyridoxal phosphate-dependent transferase, major r

DQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITGIPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLY

PatternScan: PS00595
IPR020578
230-250 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVAITGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
296-421 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox