PRGDB00069121 (Gma.31784)

From PRG Wiki
Jump to: navigation, search
Gma.31784
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 2687725 (AJ003246)
Gene Class Unknown
Domain Type
Gene Species Glycine max

Comment?

Glycine max mRNA for putative 2-hydroxydihydrodaidzein reductase

DNA Sequence

GTTGAGGATAGCACAAAGAAAAGTAAACACTGCCACAGCAAGAGTGTTCAAATGGGAGAGGGAAAAGGAAGAATTTGTGTCACTGGAGGCACAGGATTCCTTGGTTCATGGATAATCAAGAGCCTCCTTGAACATGGATATGCTGTTAATACCACTATAAGATCTGACCCAGGACGCAAGAGAGATGTTAGCTTCCTCACAAACCTACCTGGTGCATCAGAAAAGCTTAAAATTTTCAACGCTGATCTCAGCGACCCAGAGAGTTTTGGTCCAGCAGTTGAGGGTTGTGTTGGAATTTTTCACACTGCCACCCCAATTGATTTTGCGGTGAACGAGCCAGAGGAAGTGGTGACCAAAAGAGCCATTGATGGAGCACTAGGCATATTGAAAGCAGGCCTAAAAGCAAAGACTGTGAAGAGGGTTGTTTACACTTCTAGCGCCTCCACTGTTTCCTTCAGCAGCCTAGAAGAGAAAGATGTGGTGGATGAGAGTGTTTGGAGTGATGTGGATTTGCTCAGGAGTGTGAAGCCTTTTAGTTGGTCCTATGCAGTTTCAAAGGTGTTGTCAGAGAAGGCAGTGCTTGAATTTGGAGAACAGAATGGATTGGAAGTTACCACTCTTGTGCTTCCTTTTGTTGTTGGACGCTTTGTTTGTCCCAAGCTTCCTGATTCTGTTGAAAGAGCACTGCTTTTGGTGTTAGGCAAAAAGGAAGAAATTGGTGTCATTCGTTACCATATGGTACATGTGGATGATGTGGCTAGAGCACATATCTTCCTGCTTGAGCATCCTAACCCAAAAGGGAGATATAATTGCTCACCATTCATTGTGCCTATTGAAGAGATTGCTGAAATTATTTCAGCCAAATACCCAGAATATCAAATACCAGCACTAGAAGAGGTGAAGGAAATTAAAGGTGCCAAGTTACCACATTTAACCTCCCAGAAACTTGTGGATGCGGTTTTGAGTTCAAGTATATGCGTTGAGGACATATTTACGGATGCAATTGAATGCTGCAAGGAAAAGGGTTACCTTTAATCGATTTTAGCCACGAAGTTGAAAAAATAAAATTGTCGAAGATGATTGTTAGTTCGTACTATTTTCAGATCCCTGGCAATGATGCCTCTTGACATGTACTCCATTTAATGCATGATGTTTTCTTAATAAATTGACCAGGGAAATAATTCTTTTGGTTTGTCTGAATAAAAAACAATGTAATTTTCACCTTTTCCCCTTATCTCCCTAACCTCGGTGAGTATTTATTAATTTTGTCTTTTGTTAATGGTTAATCTTCTGTGAGAGAGTTTAACTTATTATTCACAGAGTTTAACTTATTATTTTTTTAGTAAATCTTTCTTTC


Protein sequences

Name Description Sequence
Gma.31784 translated coding region predicted by ESTScan from UniGene Gma.31784

VEDSTKKSKHCHSKSVQMGEGKGRICVTGGTGFLGSWIIKSLLEHGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLKIFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGILKAGLKAKTVKRVVYTSSASTVSFSSLEEKDVVDESVWSDVDLLRSVKPFSWSYAVSKVLSEKAVLEFGEQNGLEVTTLVLPFVVGRFVCPKLPDSVERALLLVLGKKEEIGVIRYHMVHVDDVARAHIFLLEHPNPKGRYNCSPFIVPIEEIAEIISAKYPEYQIPALEEVKEIKGAKLPHLTSQKLVDAVLSSSICVEDIFTDAIECCKEKGYL

Domains

Domain Start-End Description Sequence

Seg: seg
4-15 seg

STKKSKHCHSKS

HMMPanther: PTHR10366:SF9
8-344 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

SKHCHSKSVQMGEGKGRICVTGGTGFLGSWIIKSLLEHGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLKIFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGILKAGLKAKTVKRVVYTSSASTVSFSSLEEKDVVDESVWSDVDLLRSVKPFSWSYAVSKVLSEKAVLEFGEQNGLEVTTLVLPFVVGRFVCPKLPDSVERALLLVLGKKEEIGVIRYHMVHVDDVARAHIFLLEHPNPKGRYNCSPFIVPIEEIAEIISAKYPEYQIPALEEVKEIKGAKLPHLTSQKLVDAVLSSSICVEDIFTDAIECCKEKGYL

HMMPanther: PTHR10366
8-344 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

SKHCHSKSVQMGEGKGRICVTGGTGFLGSWIIKSLLEHGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLKIFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGILKAGLKAKTVKRVVYTSSASTVSFSSLEEKDVVDESVWSDVDLLRSVKPFSWSYAVSKVLSEKAVLEFGEQNGLEVTTLVLPFVVGRFVCPKLPDSVERALLLVLGKKEEIGVIRYHMVHVDDVARAHIFLLEHPNPKGRYNCSPFIVPIEEIAEIISAKYPEYQIPALEEVKEIKGAKLPHLTSQKLVDAVLSSSICVEDIFTDAIECCKEKGYL

Gene3D: G3DSA:3.40.50.720
IPR016040
23-288 no description
NAD(P)-binding domain

GRICVTGGTGFLGSWIIKSLLEHGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLKIFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGILKAGLKAKTVKRVVYTSSASTVSFSSLEEKDVVDESVWSDVDLLRSVKPFSWSYAVSKVLSEKAVLEFGEQNGLEVTTLVLPFVVGRFVCPKLPDSVERALLLVLGKKEEIGVIRYHMVHVDDVARAHIFLLEHPNPKGRYNCSPFIVPIEEIAEIISAK

superfamily: SSF51735
23-340 NAD(P)-binding Rossmann-fold domains

GRICVTGGTGFLGSWIIKSLLEHGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLKIFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGILKAGLKAKTVKRVVYTSSASTVSFSSLEEKDVVDESVWSDVDLLRSVKPFSWSYAVSKVLSEKAVLEFGEQNGLEVTTLVLPFVVGRFVCPKLPDSVERALLLVLGKKEEIGVIRYHMVHVDDVARAHIFLLEHPNPKGRYNCSPFIVPIEEIAEIISAKYPEYQIPALEEVKEIKGAKLPHLTSQKLVDAVLSSSICVEDIFTDAIECCKE

HMMPfam: PF01370
IPR001509
25-271 Epimerase
NAD-dependent epimerase/dehydratase

ICVTGGTGFLGSWIIKSLLEHGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLKIFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGILKAGLKAKTVKRVVYTSSASTVSFSSLEEKDVVDESVWSDVDLLRSVKPFSWSYAVSKVLSEKAVLEFGEQNGLEVTTLVLPFVVGRFVCPKLPDSVERALLLVLGKKEEIGVIRYHMVHVDDVARAHIFLLEHPNPKGRYNC

Seg: seg
141-154 seg

VVYTSSASTVSFSS

Seg: seg
156-170 seg

EEKDVVDESVWSDVD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox