PRGDB00069252 (Gma.45040)

From PRG Wiki
Jump to: navigation, search
Gma.45040
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 308098649 (HO760390)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

three-B10.txt SSH cDNA library induced by salt from soybean Glycine max cDNA, mRNA sequence

DNA Sequence

ACTTGAACCAAATGATTCCTTATTCCTAAATTAAATGTTATATTGTTATTGATATTGATCCTAAATCTGGAATGCACATTTAAATAACTCTTGGGTCCAGCAACAACACCCAGAGATATTGAAGGGAAATTGTTACGAAACCAGAAAGAAATTGACGATCCATTGATACAATGATGAAACCATTCTGGAATCCTTGTTCCTGCCAAATAAAACACTCCACATTCCCTAGTCTCATGCAATTCCTGACTCAGTAACATGCTTCTGCACTCGGAAGACAATGAGTGACAATCCCTTGCCGAAAAATATTGAATGCCAAATGGAATCCCTTTTATTTCTTGAAGATTCTCACAGTTATCCAGAACAATTTCCCTCCGAAGGTGAAAACCTTGGGTGCCTGCAGGATGAAGAGTAAATTCTACAATTTTCAAGGATGAGCAAAATGTTACTCTGAGCACTTCTATCCTCTGTGGAATCCCTTCAATTTTTTTAAGATTCTTGCATCCAGTTACATAAAGCATCCTCAAAAAGAACCGTTTTTTGTTCTCTGTAGGAAGAAGTGTGAGGTCTAAATCTTTCAACAATGAGCACTCTATTACAGAGAATCCTTCTAAGTTAGGTGGAACCCCTCTAATTTCCTGAAGATTCTCACAACCTTTCAAATAAATTTTTGTCAAAACGTGACATTCTTTAATGCTTGCAGGAAGAATTGTGAAATCATTATATGATAGGTATAATTCTCTCATATTGGCAAACAAATGGAGACCTCTTTGAAGGCTTTTGTCTGATATATTGCACTTTGAAAGATCAAGAACAATGGTGTTTTTAAAGACCAATGAGTTCGTTTGT


Protein sequences

Name Description Sequence
Gma.45040 translated coding region predicted by ESTScan from UniGene Gma.45040

XQTNSLVFKNTIVLDLSKCNISDKSLQRGLHLFANMRELYLSYNDFTILPASIKECHVLTKIYLKGCENLQEIRGVPPNLEGFSVIECSLLKDLDLTLLPTENKKRFFLRMLYVTGCKNLKKIEGIPQRIEVLRVTFCSSLKIVEFTLHPAGTQGFHLRREIVLDNCENLQEIKGIPFGIQYFSARDCHSLSSECRSMLLSQELHETRECGVFYLAGTRIPEWFHHCINGSSISFWFRNNFPSISLGVVAGPKSYLNVHSRFRININNNITFNLGIRNHLVQV


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
8-208 L domain-like,LRR

FKNTIVLDLSKCNISDKSLQRGLHLFANMRELYLSYNDFTILPASIKECHVLTKIYLKGCENLQEIRGVPPNLEGFSVIECSLLKDLDLTLLPTENKKRFFLRMLYVTGCKNLKKIEGIPQRIEVLRVTFCSSLKIVEFTLHPAGTQGFHLRREIVLDNCENLQEIKGIPFGIQYFSARDCHSLSSECRSMLLSQELHETR

Gene3D: G3DSA:3.80.10.10
13-172 no description

VLDLSKCNISDKSLQRGLHLFANMRELYLSYNDFTILPASIKECHVLTKIYLKGCENLQEIRGVPPNLEGFSVIECSLLKDLDLTLLPTENKKRFFLRMLYVTGCKNLKKIEGIPQRIEVLRVTFCSSLKIVEFTLHPAGTQGFHLRREIVLDNCENLQE

HMMPfam: PF00560
IPR001611
35-56 LRR_1
Leucine-rich repeat

NMRELYLSYNDFTILPASIKEC

Seg: seg
90-99 seg

LLKDLDLTLL

Seg: seg
264-270 seg

ININNNI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox