PRGDB00069257 (Gma.45487)

From PRG Wiki
Jump to: navigation, search
Gma.45487
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19936839 (BQ081034)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

san18e07.y1 Gm-c1084 Glycine max cDNA clone SOYBEAN CLONE ID: Gm-c1084-4429 5' similar to TR:Q9SRV4 Q9SRV4 F20H23.20 PROTEIN. ;, mRNA sequence

DNA Sequence

ATTTGCTACACTAGGCACTCTTTCAAGCTTGAAAGTCCTCTCATTGGTTTCTCTTGGACTCTGGGGGAACTTACCTGAAAGCATTGCTCAATTGTCTTCATTGGAAATACTTAACATTAGCTCAAATCACTTCAATGGAGCCATCCCTTCTCAGCTTTCACTTCTGAGGAACCTTCAGTCAGTGGTGCTTGATGATAACAACTTCAATGGTGAAATTTCCAACTGGGTAGGCTCACTACAAGGTTTGGCTGTGCTTAGCATGAGGAACAACTGGCTTAGTGGAAGCCTTCCAACTTCATTGAATGCTCTTCATACCTTGAGGGTGTTAGATCTATCAAATAATCAGTTATCTGGGGAACTTCCCCATCTTAAGAATTTGGCAAACCTTCAAGTTCTTAACTTGGAAAACAACACATTTGGACCTCATTTTCCTTCTCTCCCCACCAAGTTGGTTTCCCTTGTGCTTAGGAATAACAGCTTCAGGTTAAGTGTCCCTTCTAATTTAAGTTCTTTCTATCTGCTCCAAAGGCTAGACCTT


Protein sequences

Name Description Sequence
Gma.45487 translated coding region predicted by ESTScan from UniGene Gma.45487

XFATLGTLSSLKVLSLVSLGLWGNLPESIAQLSSLEILNISSNHFNGAIPSQLSLLRNLQSVVLDDNNFNGEISNWVGSLQGLAVLSMRNNWLSGSLPTSLNALHTLRVLDLSNNQLSGELPHLKNLANLQVLNLENNTFGPHFPSLPTKLVSLVLRNNSFRLSVPSNLSSFYLLQRLDL


Domains

Domain Start-End Description Sequence

superfamily: SSF52047
1-180 RNI-like,LRR

XFATLGTLSSLKVLSLVSLGLWGNLPESIAQLSSLEILNISSNHFNGAIPSQLSLLRNLQSVVLDDNNFNGEISNWVGSLQGLAVLSMRNNWLSGSLPTSLNALHTLRVLDLSNNQLSGELPHLKNLANLQVLNLENNTFGPHFPSLPTKLVSLVLRNNSFRLSVPSNLSSFYLLQRLDL

Seg: seg
4-21 seg

TLGTLSSLKVLSLVSLGL

Gene3D: G3DSA:3.80.10.10
5-180 no description

LGTLSSLKVLSLVSLGLWGNLPESIAQLSSLEILNISSNHFNGAIPSQLSLLRNLQSVVLDDNNFNGEISNWVGSLQGLAVLSMRNNWLSGSLPTSLNALHTLRVLDLSNNQLSGELPHLKNLANLQVLNLENNTFGPHFPSLPTKLVSLVLRNNSFRLSVPSNLSSFYLLQRLDL

HMMPanther: PTHR24420:SF465
5-180 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LGTLSSLKVLSLVSLGLWGNLPESIAQLSSLEILNISSNHFNGAIPSQLSLLRNLQSVVLDDNNFNGEISNWVGSLQGLAVLSMRNNWLSGSLPTSLNALHTLRVLDLSNNQLSGELPHLKNLANLQVLNLENNTFGPHFPSLPTKLVSLVLRNNSFRLSVPSNLSSFYLLQRLDL

HMMPanther: PTHR24420
5-180 FAMILY NOT NAMED,FAMILY NOT NAMED

LGTLSSLKVLSLVSLGLWGNLPESIAQLSSLEILNISSNHFNGAIPSQLSLLRNLQSVVLDDNNFNGEISNWVGSLQGLAVLSMRNNWLSGSLPTSLNALHTLRVLDLSNNQLSGELPHLKNLANLQVLNLENNTFGPHFPSLPTKLVSLVLRNNSFRLSVPSNLSSFYLLQRLDL

ProfileScan: PS51450
IPR001611
15-36 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVSLGLWGNLPESIAQLSSLE

Seg: seg
32-43 seg

LSSLEILNISSN

HMMPfam: PF00560
IPR001611
34-54 LRR_1
Leucine-rich repeat

SLEILNISSNHFNGAIPSQLS

ProfileScan: PS51450
IPR001611
106-128 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRVLDLSNNQLSGELPHLKNLA

HMMPfam: PF12799
106-139 LRR_4,Leucine Rich repeats (2 copies)

TLRVLDLSNNQLSGELPHLKNLANLQVLNLENNT

FPrintScan: PR00019
107-120 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSNNQLSGE

FPrintScan: PR00019
127-140 LEURICHRPT,Leucine-rich repeat signature

LANLQVLNLENNTF

ProfileScan: PS51450
IPR001611
129-151 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLNLENNTFGPHFPSLPTKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox