PRGDB00069297 (Gma.51787)

From PRG Wiki
Jump to: navigation, search
Gma.51787
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 7458596 (AW666046)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Glycine max

Comment?

sk31d10.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-3788 5' similar to TR:O49318 O49318 PUTATIVE RECEPTOR PROTEIN KINASE. ;, mRNA sequence

DNA Sequence

ACGAGGTTTATAAGGCAAAATTACCCGCAGGACAGATTGTTGCTGTGAAAAAACTTCATGCTGCACCCAACGAGGAAACACCCGATTCAAAAGCTTTTTCAACTGAGGTTAAAGCCTTGGCCGAAATCAAGCACCGTAACATTGTGAAGTCACTAGGATATTGTTTACATCCACGTTTTTCCTTTTTGATTTATGAGTTCCTAGAGGGTGGTAGCTTGGATAAAGTACTAACCGATGATACGCGTGCAACAATGTTTGATTGGGAAAGGAGGGTGAAGGTTGTTAAAGGTGTGGCAAGTGCTTTGTACCATATGCATCATGGTTGCTTTCCTCCTATTGTTCACCGTGACATATCAAGTAAGAATGTTCTTATACATTTGGATTATGAAGCCCACATCTCTGACTTCGGAACAGCTAAAATTCTGAATCCTGATTCACAAAATATAACCGCGTTTGCAGGCACATATGGGTATTCTGCACCAGAGCTTGCTTATACTATGGAAGTGAATGAGAAATGTGATGTCTTCAGTTTTGGAGTGCTT


Protein sequences

Name Description Sequence
Gma.51787 translated coding region predicted by ESTScan from UniGene Gma.51787

XEVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-181 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XEVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

HMMPfam: PF00069
IPR017442
2-181 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

superfamily: SSF56112
IPR011009
2-181 Protein kinase-like (PK-like)
Protein kinase-like domain

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

HMMPanther: PTHR24420:SF472
2-181 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

HMMPanther: PTHR24420
2-181 FAMILY NOT NAMED,FAMILY NOT NAMED

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

Gene3D: G3DSA:3.30.200.20
2-53 no description

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLG

HMMSmart: SM00220
IPR002290
2-181 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

HMMSmart: SM00219
IPR020635
2-181 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EVYKAKLPAGQIVAVKKLHAAPNEETPDSKAFSTEVKALAEIKHRNIVKSLGYCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

Gene3D: G3DSA:1.10.510.10
54-181 no description

YCLHPRFSFLIYEFLEGGSLDKVLTDDTRATMFDWERRVKVVKGVASALYHMHHGCFPPIVHRDISSKNVLIHLDYEAHISDFGTAKILNPDSQNITAFAGTYGYSAPELAYTMEVNEKCDVFSFGVL

PatternScan: PS00109
IPR008266
113-125 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDISSKNVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox