PRGDB00069301 (Gma.51972)

From PRG Wiki
Jump to: navigation, search
Gma.51972
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 15661726 (BI699097)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

sag32f06.y1 Gm-c1081 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1081-636 5', mRNA sequence

DNA Sequence

GTCGTGAGTTAATGGACTTTGATGCTGCCACCCTCGTTTCGAACATCTGCATGATGCCAGAACTGTATTATATTTCAGCTAGCAGTTTGCAATGGAGGCTATTGCCTGACGATGTTTTGAAATTGACCTCAGTTGTGTGTTCAAGCATTCAATTTCTTACTTTGGAACTGTCAGATGAGCTTCTTCCGCTATTTCTCTCATGTTTTGTAAATGTGATAAATTTAGAGCTATCAAGGAGTAAATTCACAGTTATTCCCGAATGCATCAAAGAATGCCGCTTTTTAACTATCCTTAATGTGGATCGTTGCGATCGTCTTCAAGAAATTAGAGGGATTCCTCCAAACTTGGAAGAATTCTCTGCAACAGGATGCCCAGCCTTGACTTCCTCAAGCATAAGCATGTTTCTGAATCAGGAACTGCATGAGGCTCGAGACATCTACTTTCATTTGCCAAGAGTAAAGATTCCAGAGTGGTTTGAGTGCCAGAGTCCGGGAAATTCAATTTCTTTCTGGTTCCGTAACGAATTCCCAGCCATAATTGTTTGCATTGTTACAAGTTTCACATTTGAGCTT


Protein sequences

Name Description Sequence
Gma.51972 translated coding region predicted by ESTScan from UniGene Gma.51972

XRELMDFDAATLVSNICMMPELYYISASSLQWRLLPDDVLKLTSVVCSSIQFLTLELSDELLPLFLSCFVNVINLELSRSKFTVIPECIKECRFLTILNVDRCDRLQEIRGIPPNLEEFSATGCPALTSSSISMFLNQELHEARDIYFHLPRVKIPEWFECQSPGNSISFWFRNEFPAIIVCIVTSFTFEL

Domains

Domain Start-End Description Sequence

superfamily: SSF52047
11-138 RNI-like,LRR

TLVSNICMMPELYYISASSLQWRLLPDDVLKLTSVVCSSIQFLTLELSDELLPLFLSCFVNVINLELSRSKFTVIPECIKECRFLTILNVDRCDRLQEIRGIPPNLEEFSATGCPALTSSSISMFLNQ

Gene3D: G3DSA:3.80.10.10
25-132 no description

ISASSLQWRLLPDDVLKLTSVVCSSIQFLTLELSDELLPLFLSCFVNVINLELSRSKFTVIPECIKECRFLTILNVDRCDRLQEIRGIPPNLEEFSATGCPALTSSSI

Seg: seg
52-67 seg

FLTLELSDELLPLFLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox