PRGDB00069478 (Gra.625)

From PRG Wiki
Jump to: navigation, search
Gra.625
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 48789262 (CO090576)
Gene Class Mlo-like
Domain Type MLO
Gene Species Gossypium raimondii

Comment?

GR__Ea10K05.f GR__Ea Gossypium raimondii cDNA clone GR__Ea10K05 5', mRNA sequence

DNA Sequence

TGGAGttttacttcagtgcttgttttcattatagctatctgaactgatctccatgataggacactctctaaacttttgatacttttgattatgatgtatatgcaacttttagtttctcttttgtttgcggattttcagctattcatctgtgctaaaggtaatcatgagactatgaacatgaactagatatatggtttcaagggctgagtgagacatttgttcgaacactttgcagaagaccaaaaattttgcagataattttagtcaagaagattggatttagcctttggggggtatttttttcctaagaaccgagaactagacggaaaacagttacagtttgagaagaaaagggaagaaaggcaaaaaggaagaaactttggagagaaatgattggtgaagcggaagaAGGGGTAACATTAGAGCATACGCCAACATGGATTGTTGCAGCAATTTGTACTGTGATTGTTGCCATTTCTTTGGCTATGGAACGTTTGCTTCATGTTATTGGGAATGTTTTGAAGAGAAAACAACAGAAACCACTCTTTGAGGCTCTTTTGAAAGTTAAAGAGGAGTTGATGCTCTTGGGGTTTATATCACTATTGCTGACAGTATTTCAGAATGCAATTTCTAAAATCTGTGTATCAAGTGACGTATTAACTGGCATGCTTCCTTGTAAAAGGGAAGACAATAAAGAAACCGGGGAGGGCTCCAATCATACGACATCACATTTTCAGAAGTATTTTGCTTTAACCCTGTCTGGTGGAACGAGGCACCTACTGGCTGAGACCCCTTCCACGGGATACTGTGCTAAGAAAGGTAAGGTACCTTTGTTGTCTGTTGAAGCGCTGCATCAACTGCA


Protein sequences

Name Description Sequence
Gra.625 translated coding region predicted by ESTScan from UniGene Gra.625

MIGEAEEGVTLEHTPTWIVAAICTVIVAISLAMERLLHVIGNVLKRKQQKPLFEALLKVKEELMLLGFISLLLTVFQNAISKICVSSDVLTGMLPCKREDNKETGEGSNHTTSHFQKYFALTLSGGTRHLLAETPSTGYCAKKGKVPLLSVEALHQLX

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
8-157 Mlo
Mlo-related protein

GVTLEHTPTWIVAAICTVIVAISLAMERLLHVIGNVLKRKQQKPLFEALLKVKEELMLLGFISLLLTVFQNAISKICVSSDVLTGMLPCKREDNKETGEGSNHTTSHFQKYFALTLSGGTRHLLAETPSTGYCAKKGKVPLLSVEALHQL

Seg: seg
18-29 seg

IVAAICTVIVAI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox