PRGDB00069528 (Han.186)

From PRG Wiki
Jump to: navigation, search
Han.186
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 1871525 (X81997)
Gene Class Unknown
Domain Type LRR
Gene Species Helianthus annuus

Comment?

H.annuus SF17 mRNA for leucine rich protein repeat

DNA Sequence

TCTTATTGTTTGTTGCCTTCTTCGTTCTTTCTCCCGTTCGGATGAGACATAGCGTGACGCCCTGATCAACTCATATATAAACAACCCCCAAAGCGTTACGTTCATTGATCTCTCTGAACACCATCACCACCATCATCCTCCTCCTCATTCCTCATCTAAATCATTATCATCGCCATGGATCCCAACCCCAGCCCAAGGAAGATGCGAATCCTCAAATATGTCATGACCAAAATCCCCAGCTTCAAACGCCGGCAATTGCAGGAGCTTGAGAACGAAAGACTAGCTCGCCCATACGCCTTGCCAGAAACCTACACCGAGCTATCTGAACGTGAATCATATACCGAGTTAGCCGAACGTGTGTCTCATTTAACAGAAGATGATATTCTAGCCAACATCCGTGCGGTTGTTGTTGAGGTTAAACAGATCCGTTCGGTTATTAAATCTCTAGGTGACCGTCCCGACCCAGAAACCGTTGATCTGGCTAGGTTGCGGTACCGAGAAGCCGAATCTCCAGTCGCGGGTCAATTCGATGAGAATGCTGAATACGATATGGAGATGGAGAAGAGGAAGAGATTGGTGAAAAGAGAGAGGCAGATGTATAAGGCATTGATTTCTTTAGATGAGATGCATGAAACGTATAGCGATCTGCTTGTTGTCGCGGAGAGGAGGCTTCAGAAGCTTTATGATACGGCTAAATCAGCTGGGAAGTTATCCGCGCTTGATAAGAGGGTGTCTTCTATGCTTCCGACGATAGCTGAGGAGGTGAAGGAGGAGATGGCGGATATTCTTCAGGATGCGTTGATGAACGGTGTTGAACGGATTGATTTGTCGCGCAGGCGGTTGCCGTTTGTTCCTGAAGCTTTTGGGAAGCTTCATACATTGGTTTCTCTTGACCTCTCCTCCAATAAACTTACGGCTATACCAGAATCACTTGCGGGACTTACGAGTCTCGAGGAGCTTAATCTTTCTGCTAATCTCTTTGAATCACTACCAGATACCATCGGCTCGTTGCAACATTTGCAGTTTCTAAATGTCTCAAGGAACAAACTCACTTCCTTGCCCGATGGCATTTGTAAATGCAGATCATTATTAGAATTGGATGCTAGTTTCAATCAGATTACATATCTTCCTGCCAACATTGGGTATGGACTAATCAATCTAAAGAAGCTTATAATGCCTTTGAACAACGTGCGCTCTCTTCCTACCTCCATCGGCGAAATGATATCTCTTCAAGTCCTTGATGTGCACTTCAATACGCTCAGAGGCCTGCCACCCTCAATCGGAATGCTTAAAAAACTCGAGGTTCTTAACTTGGGCAGTAACTTTAACGACTTTACAGCACTCCCCGAAACAATCGGGAGTCTAACTCGCCTAAGGGAACTCGATATATGCAACAATCAGATTCAACAGCTGCCCATTACATTTGGGCGGTTGGTGAGCCTGACCAGACTGGTGGTGGACCATAACCCGTTGACGGTGTCACCACCAGAGGTGGTGGCAGAAGGTGTTGAAGCTGTGAAGGTGTATATGAGCAAGAGGTTATATGATATGATTGTAGAAGAAGAGAGAAGGGTGATGTGGGAACGGGAAGAACAGGCACAACAAGCTGGGTGGTTTACGTTTTTGTTTTTCGGGCCGGCTTATGGCCCGGGCGCAACGTATCCTTACCTCACTCATCGACTTTGTACAAGTTATAAAATCCTACCATATATAGTAGCTTGGGTTTATTCTTCGTTCAACCTTGTTATTCATTGTTTTTTAAAATGTTATGTTTTTTCGGACCGGAAACAAACCTGAAAACATGTATGTAAAGGTTGCACGCAGGATGGATACATGTAACATCCTAAATTTTATTCCATTCCATGTGTTAAGGACGATTTATTGAAATAAATGGCCTCCTTTATTTGTTAAAAAA


Protein sequences

Name Description Sequence
Han.186 translated coding region predicted by ESTScan from UniGene Han.186

MDPNPSPRKMRILKYVMTKIPSFKRRQLQELENERLARPYALPETYTELSERESYTELAERVSHLTEDDILANIRAVVVEVKQIRSVIKSLGDRPDPETVDLARLRYREAESPVAGQFDENAEYDMEMEKRKRLVKRERQMYKALISLDEMHETYSDLLVVAERRLQKLYDTAKSAGKLSALDKRVSSMLPTIAEEVKEEMADILQDALMNGVERIDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLTSLEELNLSANLFESLPDTIGSLQHLQFLNVSRNKLTSLPDGICKCRSLLELDASFNQITYLPANIGYGLINLKKLIMPLNNVRSLPTSIGEMISLQVLDVHFNTLRGLPPSIGMLKKLEVLNLGSNFNDFTALPETIGSLTRLRELDICNNQIQQLPITFGRLVSLTRLVVDHNPLTVSPPEVVAEGVEAVKVYMSKRLYDMIVEEERRVMWEREEQAQQAGW


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF34
10-473 LEUCINE-RICH REPEAT-CONTAINING PROTEIN,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MRILKYVMTKIPSFKRRQLQELENERLARPYALPETYTELSERESYTELAERVSHLTEDDILANIRAVVVEVKQIRSVIKSLGDRPDPETVDLARLRYREAESPVAGQFDENAEYDMEMEKRKRLVKRERQMYKALISLDEMHETYSDLLVVAERRLQKLYDTAKSAGKLSALDKRVSSMLPTIAEEVKEEMADILQDALMNGVERIDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLTSLEELNLSANLFESLPDTIGSLQHLQFLNVSRNKLTSLPDGICKCRSLLELDASFNQITYLPANIGYGLINLKKLIMPLNNVRSLPTSIGEMISLQVLDVHFNTLRGLPPSIGMLKKLEVLNLGSNFNDFTALPETIGSLTRLRELDICNNQIQQLPITFGRLVSLTRLVVDHNPLTVSPPEVVAEGVEAVKVYMSKRLYDMIVEEERRVMWEREE

HMMPanther: PTHR23155
10-473 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MRILKYVMTKIPSFKRRQLQELENERLARPYALPETYTELSERESYTELAERVSHLTEDDILANIRAVVVEVKQIRSVIKSLGDRPDPETVDLARLRYREAESPVAGQFDENAEYDMEMEKRKRLVKRERQMYKALISLDEMHETYSDLLVVAERRLQKLYDTAKSAGKLSALDKRVSSMLPTIAEEVKEEMADILQDALMNGVERIDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLTSLEELNLSANLFESLPDTIGSLQHLQFLNVSRNKLTSLPDGICKCRSLLELDASFNQITYLPANIGYGLINLKKLIMPLNNVRSLPTSIGEMISLQVLDVHFNTLRGLPPSIGMLKKLEVLNLGSNFNDFTALPETIGSLTRLRELDICNNQIQQLPITFGRLVSLTRLVVDHNPLTVSPPEVVAEGVEAVKVYMSKRLYDMIVEEERRVMWEREE

superfamily: SSF52058
47-443 L domain-like,LRR

TELSERESYTELAERVSHLTEDDILANIRAVVVEVKQIRSVIKSLGDRPDPETVDLARLRYREAESPVAGQFDENAEYDMEMEKRKRLVKRERQMYKALISLDEMHETYSDLLVVAERRLQKLYDTAKSAGKLSALDKRVSSMLPTIAEEVKEEMADILQDALMNGVERIDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLTSLEELNLSANLFESLPDTIGSLQHLQFLNVSRNKLTSLPDGICKCRSLLELDASFNQITYLPANIGYGLINLKKLIMPLNNVRSLPTSIGEMISLQVLDVHFNTLRGLPPSIGMLKKLEVLNLGSNFNDFTALPETIGSLTRLRELDICNNQIQQLPITFGRLVSLTRLVVDHNPLTVSPPEVVAE

Gene3D: G3DSA:3.80.10.10
207-441 no description

DALMNGVERIDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLTSLEELNLSANLFESLPDTIGSLQHLQFLNVSRNKLTSLPDGICKCRSLLELDASFNQITYLPANIGYGLINLKKLIMPLNNVRSLPTSIGEMISLQVLDVHFNTLRGLPPSIGMLKKLEVLNLGSNFNDFTALPETIGSLTRLRELDICNNQIQQLPITFGRLVSLTRLVVDHNPLTVSPPEVV

HMMPfam: PF13855
213-268 LRR_8,Leucine rich repeat

VERIDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLTSLEELNLSANL

HMMSmart: SM00369
IPR003591
233-255 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHTLVSLDLSSNKLTAIPESLAG

HMMSmart: SM00364
233-252 Leucine-rich repeats, bacterial type

LHTLVSLDLSSNKLTAIPES

ProfileScan: PS51450
IPR001611
235-257 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLVSLDLSSNKLTAIPESLAGLT

FPrintScan: PR00019
236-249 LEURICHRPT,Leucine-rich repeat signature

LVSLDLSSNKLTAI

HMMSmart: SM00364
256-275 Leucine-rich repeats, bacterial type

LTSLEELNLSANLFESLPDT

HMMSmart: SM00369
IPR003591
256-278 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLEELNLSANLFESLPDTIGS

ProfileScan: PS51450
IPR001611
258-279 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEELNLSANLFESLPDTIGSL

FPrintScan: PR00019
279-292 LEURICHRPT,Leucine-rich repeat signature

LQHLQFLNVSRNKL

HMMSmart: SM00364
279-298 Leucine-rich repeats, bacterial type

LQHLQFLNVSRNKLTSLPDG

HMMSmart: SM00369
IPR003591
279-302 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQHLQFLNVSRNKLTSLPDGICKC

ProfileScan: PS51450
IPR001611
281-302 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQFLNVSRNKLTSLPDGICKC

HMMPfam: PF00560
IPR001611
281-301 LRR_1
Leucine-rich repeat

HLQFLNVSRNKLTSLPDGICK

HMMSmart: SM00364
302-321 Leucine-rich repeats, bacterial type

CRSLLELDASFNQITYLPAN

HMMSmart: SM00369
IPR003591
303-325 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

RSLLELDASFNQITYLPANIGYG

ProfileScan: PS51450
IPR001611
304-325 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLELDASFNQITYLPANIGYG

ProfileScan: PS51450
IPR001611
328-349 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKKLIMPLNNVRSLPTSIGEM

HMMSmart: SM00369
IPR003591
349-372 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MISLQVLDVHFNTLRGLPPSIGML

ProfileScan: PS51450
IPR001611
351-372 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQVLDVHFNTLRGLPPSIGML

HMMSmart: SM00364
351-368 Leucine-rich repeats, bacterial type

SLQVLDVHFNTLRGLPPS

HMMSmart: SM00364
372-393 Leucine-rich repeats, bacterial type

LKKLEVLNLGSNFNDFTALPET

ProfileScan: PS51450
IPR001611
374-394 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLNLGSNFNDFTALPETI

HMMPfam: PF12799
374-413 LRR_4,Leucine Rich repeats (2 copies)

KLEVLNLGSNFNDFTALPETIGSLTRLRELDICNNQIQQL

HMMSmart: SM00364
397-416 Leucine-rich repeats, bacterial type

LTRLRELDICNNQIQQLPIT

HMMSmart: SM00369
IPR003591
397-419 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLRELDICNNQIQQLPITFGR

ProfileScan: PS51450
IPR001611
399-420 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLRELDICNNQIQQLPITFGRL

HMMSmart: SM00369
IPR003591
420-443 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVSLTRLVVDHNPLTVSPPEVVAE

Seg: seg
435-450 seg

VSPPEVVAEGVEAVKV

Seg: seg
461-473 seg

VEEERRVMWEREE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox