PRGDB00069581 (Han.5023)

From PRG Wiki
Jump to: navigation, search
Han.5023
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90443898 (DY905781)
Gene Class N
Domain Type NBS
Gene Species Helianthus annuus

Comment?

CHAX12887.b1_M06.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX12887, mRNA sequence

DNA Sequence

AAACATCATGGCTCACAACATGTTCTCGATCCACCCACTAGGCATTCATCTTCGTTACCAATCCACTTACAGTTCATTGATATTTGCTACAAACTCAAGACTGAAAAGAACTCTAGCAATGGTGTGATCCGAACCATGTTCAGATCAGGAGCTATGGATACGGGTGAATCTGTGATCCAAGAACGAATCATCTTAAACGGGATCACTGGTATGGTGCACCCGGGCGAGCTTATGGCGGTTTTGGGTCCGTCCGGAAGTGGGAAGTCTACGTTACTTAACACGCTTGCCGGGAGGTTGCCGGAACATTGTTTTAGCGGAAAAGTTCTCGCTAATGGGCGGAAAATGTCGAAAATGGTACTTAAACGAACGGGTTTTGTCACGCAGGATGATGTTCTTTACCCGCATCTTACCGTTCGGGAGACGTTGATTTTTTGTGCTCTACTCCGTCTTCCCAGGAGTTTATCCCGGCAGGAGAAGACGGAGGTGGCGGATTCCGTTATTGCGGAGTTAGGATTGTCCAAGTGTAAGAACACCGTAATCGGGAATACGTTCATCCGTGGAGTCTCAGGTGGGGAACGGAAGCGTGTGTGTATTGCACACGAGATGCTGATGAACCCGAGCTTGTTGATACTAGACGAGCCGACGTCGGGTTTAGACTCGACGGCGGCTCACAGGCTGGTGTCCACCTTGGGTGGGTTGGCCCACCAGAAGGGAAAGACGGTGGTGATGTCTGTTCACCAACCGTCTAGCAGGGTGTTTCAGATGTTTGATTCGGTTTTGGTTTTGTCGGAAGGCCGGTGCATTTACTTTGGAAAAGGGTCTGAAGCTATGAGTTATTTTGATTCCGTTGGTTTCCGGCCTTCTTT


Protein sequences

Name Description Sequence
Han.5023 translated coding region predicted by ESTScan from UniGene Han.5023

KHHGSQHVLDPPTRHSSSLPIHLQFIDICYKLKTEKNSSNGVIRTMFRSGAMDTGESVIQERIILNGITGMVHPGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGRCIYFGKGSEAMSYFDSVGFRPSX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF23
16-288 ATP-BINDING CASSETTE TRANSPORTER,ATP-BINDING CASSETTE TRANSPORTER

SSSLPIHLQFIDICYKLKTEKNSSNGVIRTMFRSGAMDTGESVIQERIILNGITGMVHPGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGRCIYFGKGSEAMSYFDSVGFRPS

HMMPanther: PTHR19241
16-288 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

SSSLPIHLQFIDICYKLKTEKNSSNGVIRTMFRSGAMDTGESVIQERIILNGITGMVHPGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGRCIYFGKGSEAMSYFDSVGFRPS

ProfileScan: PS50893
IPR003439
23-289 ABC_TRANSPORTER_2
ABC transporter-like

LQFIDICYKLKTEKNSSNGVIRTMFRSGAMDTGESVIQERIILNGITGMVHPGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGRCIYFGKGSEAMSYFDSVGFRPSX

Gene3D: G3DSA:3.40.50.300
61-279 no description

ERIILNGITGMVHPGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGRCIYFGKGSEAMSY

superfamily: SSF52540
64-275 P-loop containing nucleoside triphosphate hydrolases

ILNGITGMVHPGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGRCIYFGKGSE

HMMSmart: SM00382
IPR003593
74-266 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGELMAVLGPSGSGKSTLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLGGLAHQKGKTVVMSVHQPSSRVFQMFDSVLVLSEGR

HMMPfam: PF00005
IPR003439
89-216 ABC_tran
ABC transporter-like

STLLNTLAGRLPEHCFSGKVLANGRKMSKMVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPRSLSRQEKTEVADSVIAELGLSKCKNTVIGNTFIRGVSGGERKRVCIAHEMLMNPSLLILDEPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox