PRGDB00069595 (Han.6100)

From PRG Wiki
Jump to: navigation, search
Han.6100
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 47027817 (AY490792)
Gene Class NL
Domain Type NBS, LRR
Gene Species Helianthus annuus

Comment?

Helianthus annuus clone Ha-NTIR11-5prime CC-NBS-LRR-like protein mRNA, complete cds

DNA Sequence

ACCAATTACTCTCATATTCCAATTTCCAGTTTACCTCTTCACTGTTAGTTAACCATGGCTGAAACCGCTGTTACTGCCCTCTTCAAAGTCATTTTCCAGAAGCTAGCCGACGAAGCCTCCAGCAAATACGATCTCTCTCAGCGAATCCAATCCGACCTGAAGAATCTGGGAAAGAAACTGTCCCAGATCCAGCCTCTACTCAATGATGCTTCTCACAAGGAGATAAAAGAAGAAGCTGTTAAACGGTGGCTGAATGATCTCCAACATTTGGCTTACGATATTGAAGACGTACTAGACGATGTAGCTACTGAAGCTATGCATCAAGAGCTGACCCAGGAGCCAGAATCAGTCATCGGCAAGATAAGAAATTTCATCCTAACTTGTTGCACGAATTTCTCTTTAAGTCGTAGATTGCATAAGAAGTTAGAAGATATTACCACCGAGTTAGAACGTCTATATAAGGAAAAATCTGAGCTAGGTTTGATTGTGAAAGGTGCAAACCCAATATATGCTAGTAGACGAGACGAAACTTCTTTGCTAGAATCTGATGTTGTTGGGCGAGAAGGTGAGAAAAAGAGATTGCTCAATCAGCTGTTTGTAGGTGAATCATCTAAGGAAAACTTTATCATCGTAGCCATCGTTGGTATGGGTGGGGTAGGGAAAACCACTCTTGCGAGAATGTTGTACAACGATACGGGAGTGAAGGATCACTTTGAACTCATGGCATGGGTTTGTGTATCCGATGAGTTTGATGTATTTAAAATAAGTCAAATCATCTATCAATCTGTGGCTAAAGAAAACAAACCGTTTGAAGATATAAATCAGCTTCAAATTGCTCTTAAAGAGAAACTTGAGGGC


Protein sequences

Name Description Sequence
Han.6100 translated coding region predicted by ESTScan from UniGene Han.6100

MAETAVTALFKVIFQKLADEASSKYDLSQRIQSDLKNLGKKLSQIQPLLNDASHKEIKEEAVKRWLNDLQHLAYDIEDVLDDVATEAMHQELTQEPESVIGKIRNFILTCCTNFSLSRRLHKKLEDITTELERLYKEKSELGLIVKGANPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVAIVGMGGVGKTTLARMLYNDTGVKDHFELMAWVCVSDEFDVFKISQIIYQSVAKENKPFEDINQLQIALKEKLEG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-264 PTHR23155:SF121,SUBFAMILY NOT NAMED

VTALFKVIFQKLADEASSKYDLSQRIQSDLKNLGKKLSQIQPLLNDASHKEIKEEAVKRWLNDLQHLAYDIEDVLDDVATEAMHQELTQEPESVIGKIRNFILTCCTNFSLSRRLHKKLEDITTELERLYKEKSELGLIVKGANPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVAIVGMGGVGKTTLARMLYNDTGVKDHFELMAWVCVSDEFDVFKISQIIYQSVAKENKPFEDINQLQIALKE

HMMPanther: PTHR23155
6-264 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTALFKVIFQKLADEASSKYDLSQRIQSDLKNLGKKLSQIQPLLNDASHKEIKEEAVKRWLNDLQHLAYDIEDVLDDVATEAMHQELTQEPESVIGKIRNFILTCCTNFSLSRRLHKKLEDITTELERLYKEKSELGLIVKGANPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVAIVGMGGVGKTTLARMLYNDTGVKDHFELMAWVCVSDEFDVFKISQIIYQSVAKENKPFEDINQLQIALKE

superfamily: SSF52540
149-266 SSF52540

NPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVAIVGMGGVGKTTLARMLYNDTGVKDHFELMAWVCVSDEFDVFKISQIIYQSVAKENKPFEDINQLQIALKEKL

Gene3D: G3DSA:3.40.50.300
164-241 G3DSA:3.40.50.300

SDVVGREGEKKRLLNQLFVGESSKENFIIVAIVGMGGVGKTTLARMLYNDTGVKDHFELMAWVCVSDEFDVFKISQII

HMMPfam: PF00931
IPR002182
170-267 NB-ARC,NBS
NB-ARC

EGEKKRLLNQLFVGESSKENFIIVAIVGMGGVGKTTLARMLYNDTGVKDHFELMAWVCVSDEFDVFKISQIIYQSVAKENKPFEDINQLQIALKEKLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox