PRGDB00069773 (Hv.6233)

From PRG Wiki
Jump to: navigation, search
Hv.6233
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151421346 (AK248330)
Gene Class Unknown
Domain Type
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf55b09, mRNA sequence

DNA Sequence

GGCACGTATTCCCCCTTCTCCTCCCCTGGTCACCGACGGGAAAAGCAAGATGGACTACATGAATGGGCCAGGCCGGAACCACCTGTTCGTCCCTGGGCCGGTGAACATCCCGGACCAGGTGATCCGCGCCATGAGCAGGCAGAACGAGGACTACCGCTCGCCGGCGATCCCTGCCCTCACCAAGACCCTCCTGGAGGACGTGAAGAAGATCTTCAAGACCACCACCGGCACCCCCTTCCTCTTCCCCACCACCGGCACCGGCGCCTGGGAGAGCGCGCTCACCAACACGCTCTCCCCGGGGGACCGGATCGTGTCCTTCTCGCTGGGGCAGTTCAGCCTGCTGTGGATCGACCAGCAGCAGCGCCTCGGCTTCAGCGTGGATGTGGTGGAGTCCGACTGGGGCTACGGCGCCGACCTCGGCGTCCTCGAGTCCAAGCTCCGCAGTGACTCGCAGCACACCATCAAGGCCATCTGCATCGTCCACAACGAGACCGCCACCGGCGTCACCAACGACCTCCACGCCGTGCGCAAGCTCCTCGATGCGTACCGGCACCCGGCGCTGCTGCTGGTGGACGGGGTGTCGTCCATCTGCGCACTGGACTTCCGCATGGACGAGTGGGGCGTGGACGTGGCGCTGACGGGGTCGCAGAAGGCGCTGTCGCTGCCGACGGGGCTGGGAATCGTGTGCGCCAGCCCCAAGGCGCTGGAGGCGGCCAAGACGGCCAAGTCGGTGCGCGTCTTCTTCGACTGGAAGGACTACCTCAAGTTCTACAAGATGGGCACCTACTGGCCCTACACGCCGTCCATCCAGCTCCTCTACGGCCTACGCGCCGGCCTCGACCTCCTCTTCGAGGAGGGCCTCGACAACGTCATCAAGAGGCACACACGCCTCGGCACCGCAACAAGGCTGGCGGTGGCAGCGTGGGGGCTCAAGAACTGCACCGAGAAGGAGGAGAACTTCAGCGACACGGTCACCGCCGTCGTCGTGCCGCCATACATCGACAGCAGCGAGATCGTCAAGCACGCATGGAAGCGGTACAACCTCAGCCTCGGGCTCGGGCTCAACAAGGTCGCCGGCAAGGTCTTCAGGATCGGCCACCTCGGCCACCTCAACGAGCTGCAACTTCTGGGTTGCCTCGGCGGGGTGGAGATGGTGCTCAAGGACATCGGGTACCCGGTGAAGCTTGGCAGCGGCGTGGCGGCCGCGGCGGCGTACCTCTCGAATTCCACGCCCCTCATCCCCTCCAGAATCTGAGCAAATTCCACGCACAAAAGCAAGGGGGTCGCGAGGAGAAGAACAAACACGTACAGTGTGCCCTGCTTGGGTCTGCTGCTGGGCACACGGCAGAGCACAGCAGAGCAGGCGTAGTATTATACTCTCTCTGTATGTAAAGTTAATTTTCACACACCCATCTATGCTAAAGGAGTATAATTTCGTCaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.6233 translated coding region predicted by ESTScan from UniGene Hv.6233

XARIPPSPPLVTDGKSKMDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
16-418 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SKMDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI

HMMPanther: PTHR21152
16-418 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

SKMDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI

superfamily: SSF53383
IPR015424
24-394 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPV

HMMPfam: PF00266
IPR000192
29-348 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYN

Gene3D: G3DSA:3.40.640.10
IPR015421
38-274 no description
Pyridoxal phosphate-dependent transferase, major r

PDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLY

Seg: seg
74-88 seg

TTTGTPFLFPTTGTG

PatternScan: PS00595
IPR020578
209-229 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Seg: seg
272-283 seg

LLYGLRAGLDLL

Gene3D: G3DSA:3.90.1150.10
IPR015422
275-400 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox