PRGDB00069793 (Hv.8700)

From PRG Wiki
Jump to: navigation, search
Hv.8700
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 2792215 (AF032686)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare NBS-LRR type resistance protein (b8) mRNA, partial cds

DNA Sequence

GGAGGGGTAGGGAAGACGACACTTGCTAAAGAGCTATACCGTAGAATCAAAGGGCAATTTGAGTGTCAGGCATTTGTGCGGACGTCCCGAAAGCCTGATGTTAGGAGTCTTCTCAGCAGCATGCTCTCACAGATTCAGCCACACCACTCCACTCACAATTGGAAGGTGCATAGCCTCATTGCTGATATCAGGACACATCTCCAAGATAAGAGGTACTTGATAGTGATAGATGATGTATGGGCTACACAAACATGGGATATCATTGTCAATGCTTTGCCGGATGGTAATCTTTGCAGTGGAATACTAATGACGACTGAAGTCGATGATGTAGCTCTGAAATGTTGTGGTTATGAGCCTAAGTATGTTCATACCATGAAACCTCTTGGTCACGATGATTCTAGTAAATTATTTTTCAGCACGGCTTTTGGCGCACAGCATGATTGTCCTCCAGAACTCAGTGAAGTTGCAAACAACATTATAAGGAAATGTGATGGCTTGCCACTAGCAGTGGTTACTGTTGCCGGTCTCTTAGTAAACCAAGGCAAACCAGAGCAATGGGATTATGTGAATAAATCCTTAGGCTATGGTTTGAGGACAAATCCTAACTCGGAAGGGATGAAACAAGTACTGAACCTTAGTTACAACAATCTTCCGCAGCATTTGAAGGCATGTATGATGTATCTCAGTATATATGAAGAGAACTACATGATTTGGAAAGATGACTTGTTAAAGCAATGGATAGCTGAAGGGTTAATCCGTGCAAACGGAGAGAAAGACATGGAAGATACCTGCCCGGGCG


Protein sequences

Name Description Sequence
Hv.8700 translated coding region predicted by ESTScan from UniGene Hv.8700

GGVGKTTLAKELYRRIKGQFECQAFVRTSRKPDVRSLLSSMLSQIQPHHSTHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIIVNALPDGNLCSGILMTTEVDDVALKCCGYEPKYVHTMKPLGHDDSSKLFFSTAFGAQHDCPPELSEVANNIIRKCDGLPLAVVTVAGLLVNQGKPEQWDYVNKSLGYGLRTNPNSEGMKQVLNLSYNNLPQHLKACMMYLSIYEENYMIWKDDLLKQWIAEGLIRANGEKDMEDTCPGX

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-200 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLAKELYRRIKGQFECQAFVRTSRKPDVRSLLSSMLSQIQPHHSTHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIIVNALPDGNLCSGILMTTEVDDVALKCCGYEPKYVHTMKPLGHDDSSKLFFSTAFGAQHDCPPELSEVANNIIRKCDGLPLAVVTVAGLLVNQGKPEQWDYVNKSLGYGLRTN

HMMPfam: PF00931
IPR002182
1-254 NB-ARC,NBS
NB-ARC

GGVGKTTLAKELYRRIKGQFECQAFVRTSRKPDVRSLLSSMLSQIQPHHSTHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIIVNALPDGNLCSGILMTTEVDDVALKCCGYEPKYVHTMKPLGHDDSSKLFFSTAFGAQHDCPPELSEVANNIIRKCDGLPLAVVTVAGLLVNQGKPEQWDYVNKSLGYGLRTNPNSEGMKQVLNLSYNNLPQHLKACMMYLSIYEENYMIWKDDLLKQWIAEGLIRA

HMMPanther: PTHR11017:SF126
1-262 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

GGVGKTTLAKELYRRIKGQFECQAFVRTSRKPDVRSLLSSMLSQIQPHHSTHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIIVNALPDGNLCSGILMTTEVDDVALKCCGYEPKYVHTMKPLGHDDSSKLFFSTAFGAQHDCPPELSEVANNIIRKCDGLPLAVVTVAGLLVNQGKPEQWDYVNKSLGYGLRTNPNSEGMKQVLNLSYNNLPQHLKACMMYLSIYEENYMIWKDDLLKQWIAEGLIRANGEKDMED

HMMPanther: PTHR11017
1-262 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAKELYRRIKGQFECQAFVRTSRKPDVRSLLSSMLSQIQPHHSTHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIIVNALPDGNLCSGILMTTEVDDVALKCCGYEPKYVHTMKPLGHDDSSKLFFSTAFGAQHDCPPELSEVANNIIRKCDGLPLAVVTVAGLLVNQGKPEQWDYVNKSLGYGLRTNPNSEGMKQVLNLSYNNLPQHLKACMMYLSIYEENYMIWKDDLLKQWIAEGLIRANGEKDMED

Gene3D: G3DSA:3.40.50.300
2-110 no description

GVGKTTLAKELYRRIKGQFECQAFVRTSRKPDVRSLLSSMLSQIQPHHSTHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIIVNALPDGNLCSGILMTTEVDDV

FPrintScan: PR00364
IPR000767
66-80 DISEASERSIST
Disease resistance protein

HLQDKRYLIVIDDVW

FPrintScan: PR00364
IPR000767
163-177 DISEASERSIST
Disease resistance protein

CDGLPLAVVTVAGLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox