PRGDB00070003 (Hv.22288)

From PRG Wiki
Jump to: navigation, search
Hv.22288
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38174808 (AJ495770)
Gene Class Unknown
Domain Type LRR
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare partial mRNA for putative Cf2

DNA Sequence

TCTATTGATCTCCCAAGCAACATCCACTTCCCATGGCCAAGCGAGTGTGTCAGGAGCCTGCATCAGCAGCGAGCGAGACGCACTTCTGTCCTTCAAGGCAAGCCTCCTGGACCCTGCTGGCCATCTCTCGTCATGGCAGGGTGAGGATTGTTGCCAATGGAAGGGAGTCCGCTGTAGCAACAGAACGGGCCATCTCATCAAGCTCAACCTCCGCAACGTCGACATGCGTGACTACGGGTACGCAACCATCTCATCAAGCCGCCCGAACAGCAGCAGATCAGTGAGCTTGTCGGTAGGTCAGATGAGCTCTTCTTTGGCTACTTTACAACACCTGAGATATCTTGATCTGAGTTGGAATGACTTCAAGGGCACAAGCATCCCTGTCTTTTTGGCTTCTCTCAAGAACCTAAGGTACCTCAACCTATCGTCGGCAGGATTCAGTGGGAGAATTCCTTCCCAACTTGGCAATCTCTCAAAGTTGCAATATCTTGATCTCAGTTGGAATTCTAATTATGTTGATTGGAATTGGAATAGGTTTTACATAGTGGATCTTGCATGGTTGCCACGTCTCTCTTTGTTGAGACATCTTGACATGAGTTATGTGGATCTTGGTTCTGCGaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.22288 translated coding region predicted by ESTScan from UniGene Hv.22288

XLLISQATSTSHGQASVSGACISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNSNYVDWNW

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
14-170 FAMILY NOT NAMED,FAMILY NOT NAMED

QASVSGACISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNS

superfamily: SSF52058
19-170 L domain-like,LRR

GACISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNS

Gene3D: G3DSA:3.80.10.10
21-170 no description

CISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNS

HMMPfam: PF08263
IPR013210
23-60 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCS

Seg: seg
85-105 seg

SSSRPNSSRSVSLSVGQMSSS

HMMPfam: PF12799
111-147 LRR_4,Leucine Rich repeats (2 copies)

HLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGF

HMMPfam: PF13504
160-170 LRR_7,Leucine rich repeat

KLQYLDLSWNS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox