PRGDB00070016 (Hv.23865)

From PRG Wiki
Jump to: navigation, search
Hv.23865
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 44805512 (CK122510)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Hordeum vulgare

Comment?

BES1824103l17 BES1824 Hordeum vulgare subsp. vulgare cDNA clone MPMGp2010L173 5-PRIME, mRNA sequence

DNA Sequence

CTCCGATGGGGTGCTTCCAGTCCAAGCCGGCGGGGAAgccgctgccgcccgacgccgacgccgccctcccgcccgacgaccccgcagatcccgaggcggcgaacggagcggacggggcgggcgcggacggcgacgagaaggacggggcgaagcgggcggTGCCGGTGTTCAGGGAGTTCGGGCTCGCCGAGCTGCGGGCCGCCACCAAGGGCTTCAGCGCCGACCTCATCGTCTCCGAGAGCGGCGAGAAGGCGCCCAACGTCGTCTACCGGGGCCGCCTCGACGGCGGTCGCCTCATCGCCGTCAAGCGCTTCTCCCGCCTCTCCTGGCCCGACCCGCAGCAGTTCCTCGCGGAAGCGGCCGGCGTGGGGAAGGTGCGGCACAAGCGACTGGTCAACCTCATTGGCTGCTGCGCCGAGGGTGACGAGAGGCTGCTCGTCGCGGAGTACATGCCCAACGACACATTGTCCAAGCACCTCTTCCACTGGGATAAGCAGCCGTTGCCATGGGAAATGCGATTGAGGGTTGCACATTACATTGCGCAAGCTCTCGATCATTGCAATGCAGAGAACAGGAAAATCTATCATGACTTGAATGCCTACAGAGTACTTTTTTGATGAGGAAGGTGATCCNTCGCTTGTCAAGTTTCGGACTAATGAAGAACAGCCGTGGACGGCAAAAGNTATAGCACCAACCTGGNTTTACACCCCTCCAA


Protein sequences

Name Description Sequence
Hv.23865 translated coding region predicted by ESTScan from UniGene Hv.23865

XPMGCFQSKPAGKPLPPDADAALPPDDPADPEAANGADGAGADGDEKDGAKRAVPVFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEYFFDEEGDPSLVKFRTNEEQPWTAKXIAPTWXYTPPX

Domains

Domain Start-End Description Sequence

Seg: seg
10-50 seg

PAGKPLPPDADAALPPDDPADPEAANGADGAGADGDEKDGA

superfamily: SSF56112
IPR011009
44-238 Protein kinase-like (PK-like)
Protein kinase-like domain

GDEKDGAKRAVPVFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEYFFDEEGDPSLVKFRTNEEQPWTAKXIAPTWXYTPP

HMMPanther: PTHR24420:SF829
57-238 SUBFAMILY NOT NAMED

FREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEYFFDEEGDPSLVKFRTNEEQPWTAKXIAPTWXYTPP

HMMPanther: PTHR24420
57-238 FAMILY NOT NAMED,FAMILY NOT NAMED

FREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEYFFDEEGDPSLVKFRTNEEQPWTAKXIAPTWXYTPP

Gene3D: G3DSA:3.30.200.20
58-138 no description

REFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCC

ProfileScan: PS50011
IPR000719
75-239 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEYFFDEEGDPSLVKFRTNEEQPWTAKXIAPTWXYTPPX

HMMPfam: PF07714
IPR001245
89-203 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VYRGRLDGGRLIAVKRFSRLSWPDPQQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEY

Gene3D: G3DSA:1.10.510.10
139-238 no description

AEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRLRVAHYIAQALDHCNAENRKIYHDLNATEYFFDEEGDPSLVKFRTNEEQPWTAKXIAPTWXYTPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox