PRGDB00070020 (Hv.24676)

From PRG Wiki
Jump to: navigation, search
Hv.24676
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 119021555 (EH090867)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Hordeum vulgare

Comment?

HvH3E4 HvH Hordeum vulgare cDNA clone HvH3E4, mRNA sequence

DNA Sequence

GGCTCGAGGGATAGCATATCTTCATGAAGATTGTCATCCCCGAATAATCCACCGAGATATAAAATCCTCTAATATTCTGGTGGATAATAACTTCGAGGCACAGGTTGCTGATTTTGGTCTTGCAAGGCTAGCCATGGATTTTGCCACACATGTAACTACACGGGTGATGGGAACTTTTGGGTACATGGCTCCAGAGTATGCATCGAGTGGCAAGCTGACTGAGAAATCAGATGTGTTCTCCTTTGGTGTTGTCCTCCTAGAGCTCATTACAGGACGAAAGCCTGTCGATGCATCGAACCCATTGGGTGATGAGAGCCTCGTCGAGTGGGCTAGGCCACTGCTCACGCAAGCGCTCGAGACCGGCAATGTAGGGGAGCTGTTGGACCCCAGGCTGGACAAAAACTTCAACGAGGTCGAGATGTTCCATATGATCTGCGGTGAAGCGGCTTAAGTGGACAGTCCAGTTTAGGTCATTCACCTTCCTTGTATCATGGCATTACTGGTCCTAGAGTCAGAGACTCTGAACAATCAGCTTCTCAACAAACAACAAGGACTAGCAACAGAACTATTCGGAATTCTGCAGATTCAGTAAGGATGAGACGTCCTTCTACTCAGCAGGCTAGGATGAGGATGCCAGATGAAACAGAGCAGGGCGTGTTTGCTATGCGTGAGACTGTTTCGGGGGCTCGTCAACCAGATTGGGCCCGATTTTCGTTGGACGAAGTTCCCCCACAGAGGTCAGCTAGGCCTTTTCCTATGGAACTTCCTCGTGCGATTTACTCTTCTAGTCGTCAAGGCTCTAGTAACCCGTACATCGAGGAGCAGAGCGAGTTCTCGTCCCGAGGATAGCTCATCACAATGTTTAGAGATGTCTACAGACGCATGAACATGGACGGAATTGCAGAGGTGTTGCTAGCATTGGTAAGATCTTTATGGACGCGCGGATGTGGACACAGTGGACATTGGACTAATATAGAGTCATCGCTGCAACATTGCATCTGAATAAACTGGAGCGTGAAGGAGCATCTGGTGCAGCTTTTCATATTTTGGACAAGATGGAAGTGTACTTCACATGCTGACTGCAGCAGCTGGCCTGACATACATTGCAGATGCTTTTCTTGATGAAG


Protein sequences

Name Description Sequence
Hv.24676 translated coding region predicted by ESTScan from UniGene Hv.24676

XARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDESLVEWARPLLTQALETGNVGELLDPRLDKNFNEVEMFHMICGEAALSGQSSLGHSPSLYHGITGPRVRDSEQSASQQTTRTSNRTIRNSADSVRMRRPSTQQARMRMPDETEQGVFAMRETVSGARQPDWARFSLDEVPPQRSARPFPMELPRAIYSSSRQGSSNPYIEEQSEFSSRGXLITMFRDVYRRMNMDGIAEVLLALVRSLWTRGCGHSGHWTNIESSLQHCI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-221 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDESLVEWARPLLTQALETGNVGELLDPRLDKNFNEVEMFHMICGEAALSGQSSLGHSPSLYHGITGPRVRDSEQSASQQTTRTSNRTIRNSADSVRMRRPSTQQARMRMPDETEQGVF

HMMSmart: SM00220
IPR002290
1-132 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDESLVEWARPLLTQALETGNVGELLDPRL

HMMPfam: PF00069
IPR017442
2-101 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNP

superfamily: SSF56112
IPR011009
2-117 Protein kinase-like (PK-like)
Protein kinase-like domain

ARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDESLVEWARPLLTQ

Gene3D: G3DSA:1.10.510.10
2-105 no description

ARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDE

HMMPanther: PTHR24420:SF644
2-145 SUBFAMILY NOT NAMED

ARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDESLVEWARPLLTQALETGNVGELLDPRLDKNFNEVEMFHMI

HMMPanther: PTHR24420
2-145 FAMILY NOT NAMED,FAMILY NOT NAMED

ARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQVADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASNPLGDESLVEWARPLLTQALETGNVGELLDPRLDKNFNEVEMFHMI

PatternScan: PS00108
IPR008271
16-28 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILV

Seg: seg
177-195 seg

QSASQQTTRTSNRTIRNSA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox