PRGDB00070021 (Hv.24777)

From PRG Wiki
Jump to: navigation, search
Hv.24777
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151420087 (AK251439)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf117d04, mRNA sequence

DNA Sequence

GAAGCGACCGTCCCACGTGACGGCATCAGTCCTCAGTCCTCTCCACTCCCCCTCTACCTCGCCGCCTCCGCCGCGCTTGTTCCTCCCAACCCGCGGCACCTCACCCCGACGCTCTGCGTCTCTGCTCTTCCCGAGGTGACGCCCGCTCCCTGCTGCTCTTCCCCGCCGTCCACTCCTCTCCGCACTGCCCTCCCTCGGCGACGACACCAATGTCGGCAGGTATCCGGGGGAAGGGCGACGACATACTGGTGGCCCAGCGGCGATGGTGACGGCTGAGCCGGCGAAGGAATCTCTCCGGCATTAGCTCCGAGCTTCAAGGAATGGGCAGTGTTCTAGctctctctctctGCTGCCTAACCTTGCTACCGAGCTGGGCCTATGGCCTCGGCTCCATGGGATCCATCTCGGTGTCCTACGGCGAGGACGGTCCGGTGTTCTGCGGCCTCAGCTCGGACGGCTCCCACTTGGTCGCCTGCTCCGGCGCGGACGCCTCTGTCGTCTACGGTGCTCCCCTCAGGATCCCCTTCCTCGGCCTCACCGCGGGGGATGGGTTCGCGTGCGGTCTCCTGCTGGATACCAGTCAGCCTTACTGCTGGGGGAGCAACTCATATGTCAAGATCGGGGTGCCGCAACCAATGGTCGAGGGCGTGGAGTATTCTATGCTCAGCGCCGGGGACAACCACCTCTGTGCACTGCGGATGCCTGACAAGGGGATTCCTCACGGTGATACTTCAGTGATAGATTGCTGGGGGTACAACATGACTGCCACACATGTTGTCGCCGGAGCCGTGTCCACCATATCAGCCGGCTCGGTGTTCAATTGTGCCTTGTTTTCACGGAACAGGACAGTCTTCTGCTGGGGTGATGAGACAGTGAGTGGTGTGATTGGGCTAGCGCCGAGGAATGTCAAGTTCCAGTCCATAGGAGCAGGGGGTTACCATGTCTGTGGGGTGCTGGAGAATGCACAAGTCTTCTGCTGGGGAAGGAGCTTGGAGATGCAGCAGGTGTCACCTACCGGTGCTATCGGTGAAGGCGATGTAAGCATAGTGCCCATGGATGCAATGGTCTCCGTAGTCGGCGGACGATTCCATGCTTGCGGCATCAGGAGCCTTGATCACCAAGTAGCTTGCTGGGGTTTCCAACTTCAGAACAGTACATCAGCACCCAAAGGTCTCAGGTTGTATGCAATAGTGGCTGGAGACTACTTTACTTGTGGGGTGCCTGCTGAGACATCCATGAAGCCAAGGTGCTGGGGCAATAGTGGACCATTGGCACTACCAATGGCGGTATCGCCTGGGATTTGTGTATCTGCTGCATGCAGCCCCGGATACTACGAGTATGTTAACCATGGTGAGCTTGGTGGCAGTAAGGCTTGTAAGCCTGGAAACTCTAGACTCTGCTTGCCCTGCAGTGCTGCCTGTCCAGACAACTCGTATGAGTCATCACCCTGCAATGTCACGGCTGACCGTGTGTGCCAGTTTGATTGCTCGAGGTGTGTCTCAGATGAGTGTTGGTCATACTGCACATCCCGGAAGCAGACCAACAACCATAAGTCAATGGATTTTCAGATGCACATTTTTGTGGCAGAGATTGCATTTGCCATCATCTTGATTTTCACAGTGACAGCCATTGCTTGCCTATATGTACGGCACAAGCTTCGAGATTGCCGATGTTCAAAGAGCAAGTTGAGGATGACAAAGAGTACAACATACTCTTTTCGAAAGGATAACATGAAGATCCAGCCTGACGTGGAAGATCTGAAGATCAGGAGAGCTCAGGAATTTTCCTATGAGGAGTTGGAACAAGCAACCGATGGCTTCTCGGAGGATTCACAAGTCGGCAAAGGTAGCTTTTCATGTGTATTCAGGGGCATTCTGAGAGATGGGACAGTCGTTGCTGTGAAGCGTGCAATAAAAGTATCGGATGCGAAGAAAAGCTCAAAGGAGTTCCATACTGAACTTGACCTCCTCTCTAGGCTCAACCATGCACATTTGCTCGACCTACTTGGTTACTGTGAGGATGGCAGCGAGAGGCTCTTGGTTTATGAGTTCATGGCTCATGGATCCCTGTACCAGCATCTGCATGGCAAGGATTCAAACTTGAAGAAGCAACTGAACTGGACCAGGCGGGTTACCATTGCTGTCCAGGCTGCTCGTGGAATAGAGTATTTGCATGGCTATGCTTGCCCACCAGTAATTCACCGAGACATTAAGTCTTCAAACATATTGATTGATGAGGATCACAATGCACGTGTTGCCGACTTTGGTCTATCTATAATGGGCCCTGTAGATAGCGGCACACCACTCTCAGAGCTGCCGGCAGGGACACTTGGGTACCTTGACCCTGAGTACTACCGTCTCCATTACTTGACGACAAAGTCCGATGTCTACAGCTTTGGAGTTGTTCTTCTAGAAATTCTAAGTGGCAGGAAAGCCATTGACATGCAGCTTGAGGAGGGCAATATTGTTGAATGGGCAGCCCCGTTGATCAAAGCTGGGGACATTTCTGGCATCCTTGATCCAGCCTTATCTCCTCCCTCTGACCCGGAGGCTTTGAAGAAGATTGCAGCTGTGGCATGCAAGTGTGTAAGAATGCGAGGCAAAGACCGGCCTTCCATGGACAAGGTGACAACATCTCTAGAGCGTGCACTTGCACTGCTGATGGGCAGCCCATGCATCGAGCAACCCATTCTGCCAACTGAAGTTGTTCTTGGGAGCAGCCGCATGCACAAAAAAGTATCACAGAGGTCATCCAATCAGTCGTGCTCAGAGAATGAGCTCGTTGATGGGGACGACCAGCGGATCGAGTACAGGGCGCCATCTTGGATAACGTTTCCAAGCGTGACCTCGTCGCAGAGGAGGAAATCATCAGCGTCGGAAGCCGACCTGGATGGCCGAACAACCACAGATGGGAGGAATGTCGGGAGCAGCATAGGAGATGGTCTGCGGTCACTGGAGGAAGAGATTGGGCCGGCGTCTCCACAGGAGAACCTGTACTTGCAGCACAACTTCTGATGAAATGCCAAGATCAGCTGAAAACATGGAAACCGTCTGCCGTTTTAAGTTCAGACTTTGTGACCTGTTGCTTTGGCCATTCCGGAGAGAGGATCTAGCTATATAGAGTACGTACTGGAAGGATTTTTAGCTTCTGGAGGCATTTCTTTGTAGATTGATTCGGTCGTCCTATAATTGCCACTTGTATTTATAAGTGGAATGGCCACAGTTGATGAGTCCTGTTCTGTAGCACaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.24777 translated coding region predicted by ESTScan from UniGene Hv.24777

EATVPRDGISPQSSPLPLYLAASAALVPPNPRHLTPTLCVSALPEVTPLPAALPRRPLLSALPSLGDDTNVGRYPGEGRRHTGGPAAMVTAEPAKNLSGISSELQGMGSVLALSLCCLTLLPSWAYGLGSMGSISVSYGEDGPVFCGLSSDGSHLVACSGADASVVYGAPLRIPFLGLTAGDGFACGLLLDTSQPYCWGSNSYVKIGVPQPMVEGVEYSMLSAGDNHLCALRMPDKGIPHGDTSVIDCWGYNMTATHVVAGAVSTISAGSVFNCALFSRNRTVFCWGDETVSGVIGLAPRNVKFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVSPTGAIGEGDVSIVPMDAMVSVVGGRFHACGIRSLDHQVACWGFQLQNSTSAPKGLRLYAIVAGDYFTCGVPAETSMKPRCWGNSGPLALPMAVSPGICVSAACSPGYYEYVNHGELGGSKACKPGNSRLCLPCSAACPDNSYESSPCNVTADRVCQFDCSRCVSDECWSYCTSRKQTNNHKSMDFQMHIFVAEIAFAIILIFTVTAIACLYVRHKLRDCRCSKSKLRMTKSTTYSFRKDNMKIQPDVEDLKIRRAQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSLERALALLMGSPCIEQPILPTEVVLGSSRMHKKVSQRSSNQSCSENELVDGDDQRIEYRAPSWITFPSVTSSQRRKSSASEADLDGRTTTDGRNVGSSIGDGLRSLEEEIGPASPQENLYLQHNF

Domains

Domain Start-End Description Sequence

Seg: seg
10-29 seg

SPQSSPLPLYLAASAALVPP

Seg: seg
48-65 seg

PLPAALPRRPLLSALPSL

Seg: seg
111-121 seg

LALSLCCLTLL

superfamily: SSF50985
IPR009091
128-379 RCC1/BLIP-II
Regulator of chromosome condensation/beta-lactamas

LGSMGSISVSYGEDGPVFCGLSSDGSHLVACSGADASVVYGAPLRIPFLGLTAGDGFACGLLLDTSQPYCWGSNSYVKIGVPQPMVEGVEYSMLSAGDNHLCALRMPDKGIPHGDTSVIDCWGYNMTATHVVAGAVSTISAGSVFNCALFSRNRTVFCWGDETVSGVIGLAPRNVKFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVSPTGAIGEGDVSIVPMDAMVSVVGGRFHACGIRSLDHQVACWGF

Gene3D: G3DSA:2.130.10.30
IPR009091
262-420 no description
Regulator of chromosome condensation/beta-lactamas

AVSTISAGSVFNCALFSRNRTVFCWGDETVSGVIGLAPRNVKFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVSPTGAIGEGDVSIVPMDAMVSVVGGRFHACGIRSLDHQVACWGFQLQNSTSAPKGLRLYAIVAGDYFTCGVPAETSMKPRCWGNS

ProfileScan: PS50012
IPR000408
281-320 RCC1_3
Regulator of chromosome condensation, RCC1

RTVFCWGDETVSGVIGLAPRNVKFQSIGAGGYHVCGVLEN

ProfileScan: PS50050
IPR001368
438-491 TNFR_NGFR_2
TNFR/CD27/30/40/95 cysteine-rich region

ACSPGYYEYVNHGELGGSKACKPGNSRLCLPCSAACPDNSYESSPCNVTADRVC

HMMPanther: PTHR24420:SF840
463-955 SUBFAMILY NOT NAMED

SRLCLPCSAACPDNSYESSPCNVTADRVCQFDCSRCVSDECWSYCTSRKQTNNHKSMDFQMHIFVAEIAFAIILIFTVTAIACLYVRHKLRDCRCSKSKLRMTKSTTYSFRKDNMKIQPDVEDLKIRRAQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSLERALALLMGSPCIEQPILPTEVVLGSSRMHKKVSQRSSNQSCSENELVDGDDQRIEYRAPSWITFPSVTSSQRRKS

HMMPanther: PTHR24420
463-955 FAMILY NOT NAMED,FAMILY NOT NAMED

SRLCLPCSAACPDNSYESSPCNVTADRVCQFDCSRCVSDECWSYCTSRKQTNNHKSMDFQMHIFVAEIAFAIILIFTVTAIACLYVRHKLRDCRCSKSKLRMTKSTTYSFRKDNMKIQPDVEDLKIRRAQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSLERALALLMGSPCIEQPILPTEVVLGSSRMHKKVSQRSSNQSCSENELVDGDDQRIEYRAPSWITFPSVTSSQRRKS

superfamily: SSF56112
IPR011009
576-879 Protein kinase-like (PK-like)
Protein kinase-like domain

NMKIQPDVEDLKIRRAQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSL

Gene3D: G3DSA:3.30.200.20
590-684 no description

RAQEFSYEELEQATDGFSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFM

ProfileScan: PS50011
IPR000719
606-883 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSLERAL

HMMSmart: SM00220
IPR002290
606-886 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSLERALALL

HMMSmart: SM00219
IPR020635
606-879 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEDSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTSL

HMMPfam: PF07714
IPR001245
609-878 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DSQVGKGSFSCVFRGILRDGTVVAVKRAIKVSDAKKSSKEFHTELDLLSRLNHAHLLDLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTTS

PatternScan: PS00107
IPR017441
612-638 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGSFSCVFRGILRDGTVVAVKRAIK

Gene3D: G3DSA:1.10.510.10
685-877 no description

AHGSLYQHLHGKDSNLKKQLNWTRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEALKKIAAVACKCVRMRGKDRPSMDKVTT

PatternScan: PS00108
IPR008271
731-743 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox