PRGDB00070022 (Hv.24848)

From PRG Wiki
Jump to: navigation, search
Hv.24848
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18226879 (AV931082)
Gene Class Unknown
Domain Type LRR
Gene Species Hordeum vulgare

Comment?

AV931082 K. Sato unpublished cDNA library, cv. Haruna Nijo second leaf stage seedling leaves Hordeum vulgare subsp. vulgare cDNA clone basd18h12 3', mRNA sequence

DNA Sequence

TGTTGCTNATGTAGGATTAGGAAAGAAAGCCAACCGAGTCCTAGTAGTATTAGGATTCCTAGTCCTAGTCTATTTCCATAGTCCCTTGTGGACGTGTATAAAAGACACCCTAGGGGTGTTGATTGTAACACCAGAAAAACGAAAAGCAATACAAAGCAAAGGCTCGACACGGGCCTTTAGCCATCAAATCCATCGATCAGTTTTATTCGTGTCGCTAGTTACGCAAGTTCCGTCAAGTAGCCGGCCAAAGCAAGAATCGCGTAGGCACGCCTGTACAGCTGCATACGCACGTTCAAAAGCCAACAGGAGGAGGACGGCGCGCATAGCATCTGCAGGCGTATGCCGATTCACTTTGGGATGCCTATTCTCTCAAAGTATTTACGTGGAACAGAGGAGAGCAAGTGGAAGTACTCCCCACCTTCTCTGCATCGTCTTTGCAACTCCGGGCAGAGATGGATGCTACAGTATTCGAGGGCTGGCAACCGCTCCAGGAGACCATGCGGGAATTCCTCCATACCTGGACAACCCCAAATCTCCAATTCCCTCAGAGAAGTGAGGCCACACATCCCATCAGGCAGCACTTTCAGGCTCCTGCAGTCGCTCACATAGAGACTCCTCAGCTTGGCCAGTTTCCCAAGGTTCGAAGGCAGTGCTACTACACTGCGGCAGTTCTGAATCGTCAAATGCTCCAGGG


Protein sequences

Name Description Sequence
Hv.24848 translated coding region predicted by ESTScan from UniGene Hv.24848

XLEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQRRCREGGEYFHLLSSVPRKYFERIGIPKXIGIRLQMLCAPSSSCWLLNVRMQLYRRAYAILALAGYLTELA

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
2-87 no description

LEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQ

superfamily: SSF52058
2-86 L domain-like,LRR

LEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPEL

HMMPanther: PTHR23155:SF182
2-102 OS08G0543500 PROTEIN,OS08G0543500 PROTEIN

LEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQRRCREGGEYFHLLSS

HMMPanther: PTHR23155
2-102 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQRRCREGGEYFHLLSS

HMMPfam: PF13855
2-58 LRR_8,Leucine rich repeat

LEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGC

Seg: seg
140-154 seg

LYRRAYAILALAGYL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox