PRGDB00070025 (Hv.25692)

From PRG Wiki
Jump to: navigation, search
Hv.25692
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19494094 (AU252307)
Gene Class Unknown
Domain Type
Gene Species Hordeum vulgare

Comment?

AU252307 salt-stressed barley root cDNA Hordeum vulgare subsp. vulgare cDNA clone BR-M17 similar to PDR5-like ABC transporter, mRNA sequence

DNA Sequence

GAGGGACAGCAAGATCAAACCAGGGTACAATCCGGCAACTTGGATGCTGGAAGTGACCTCACAGGCACAAGAAGACATACTAGGTGTTAGTTTCGCAGAAGTCTACAAGAACTCAGATCTGTACCAGAGAAACCAGAGCGTGATCAGGGACCTAAGCAGGGCCCCTGCTGGCTCCAATGATCTCTACTTCCCGACGCAGTACTCACAGAGCTCCATCACCCAGTGCATGGCGTGCCTGTGGAAGCAGCACCTGTCCTACTGGAGGAACCCCCAGTACACCGTGGTCCGCTTCTTCTTCTCCCTCGTCGTCGCGCTCATGTTCGGAACCACATTCTGGCAACTCGGGGGCAAGACGTCAAGGAAGCAGGACCTGTTCAACGCGATGGGTTCCATGTACGCGGCGGTGCTCTTCATGGGGATCTCCTACTCATCGTCNGTGCAGCCTGTGGTGGCGGTGGAGCGGACGGTCTTCTACCGGGAGCGGGCGGCCGGGATGGGTTCCATGTACGCGGCGGGTGCTCTTCATGGGGATCTCCTACTCATCGTCGGTGCAGCCTGTGGTGCCGGTGGAGCGGACGGTCTTCTACCGGGAGCGGCGGCCGGGATGTACTCGGCGCTGCCGTACGCATTCGGGCAGGTGGTGGTGGAGCTCCCCTACGTGCTGGTGCAGTCGCTGGCATACGGAGTGATCGTCTACGCCATGATCGGCTTCGAGTGGGATGCCAAGAAGTTCTGCTGGTACCTCTACTTCATGCACTTCACGCTGCTCTACTTCACCTACTACGGCATGCTCGCCGTGGGGCTCACCCCCAGCTACAACATCGCCTCCATCGTCTCCTCCTTCTTCTACGGAGTGTGGAACCTCTTCTCGGGCTTCGTCATCTCACGGCCGACGATGCCGGTGTGGTGGAGGTGGTACTCGTGGGTGTGCCCTGTGTCATGGACACTCTACGGGCTGGTGGCCTCACAGTTCGGTGACCTCACGGAGATTCTCGACAGCGGCGAGCCCATCGACGCTTTCCTCAAGAGCTTCTTCGGATTCGAGCACGACTTCCTGGGTGTCGTCGCCGTCGTCACTGCCGGGTTCGCCGTCCTGTTT


Protein sequences

Name Description Sequence
Hv.25692 translated coding region predicted by ESTScan from UniGene Hv.25692

XRDSKIKPGYNPATWMLEVTSQAQEDILGVSFAEVYKNSDLYQRNQSVIRDLSRAPAGSNDLYFPTQYSQSSITQCMACLWKQHLSYWRNPQYTVVRFFFSLVVALMFGTTFWQLGGKTSRKQDLFNAMGSMYAAVLFMGISYSSSVQPVVAVERTVFYRERAAGMGSMYAAGALHGDLLLIVGAACGAGGADGLLPGAAAGMYSALPYAFGQVVVELPYVLVQSLAYGVIVYAMIGFEWDAKKFCWYLYFMHFTLLYFTYYGMLAVGLTPSYNIASIVSSFFYGVWNLFSGFVISRPTMPVWWRWYSWVCPVSWTLYGLVASQFGDLTEILDSGEPIDAFLKSFFGFEHDFLGVVAVVTAGFAVLF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
4-367 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

SKIKPGYNPATWMLEVTSQAQEDILGVSFAEVYKNSDLYQRNQSVIRDLSRAPAGSNDLYFPTQYSQSSITQCMACLWKQHLSYWRNPQYTVVRFFFSLVVALMFGTTFWQLGGKTSRKQDLFNAMGSMYAAVLFMGISYSSSVQPVVAVERTVFYRERAAGMGSMYAAGALHGDLLLIVGAACGAGGADGLLPGAAAGMYSALPYAFGQVVVELPYVLVQSLAYGVIVYAMIGFEWDAKKFCWYLYFMHFTLLYFTYYGMLAVGLTPSYNIASIVSSFFYGVWNLFSGFVISRPTMPVWWRWYSWVCPVSWTLYGLVASQFGDLTEILDSGEPIDAFLKSFFGFEHDFLGVVAVVTAGFAVLF

HMMPanther: PTHR19241
4-367 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

SKIKPGYNPATWMLEVTSQAQEDILGVSFAEVYKNSDLYQRNQSVIRDLSRAPAGSNDLYFPTQYSQSSITQCMACLWKQHLSYWRNPQYTVVRFFFSLVVALMFGTTFWQLGGKTSRKQDLFNAMGSMYAAVLFMGISYSSSVQPVVAVERTVFYRERAAGMGSMYAAGALHGDLLLIVGAACGAGGADGLLPGAAAGMYSALPYAFGQVVVELPYVLVQSLAYGVIVYAMIGFEWDAKKFCWYLYFMHFTLLYFTYYGMLAVGLTPSYNIASIVSSFFYGVWNLFSGFVISRPTMPVWWRWYSWVCPVSWTLYGLVASQFGDLTEILDSGEPIDAFLKSFFGFEHDFLGVVAVVTAGFAVLF

HMMPfam: PF01061
IPR013525
74-181 ABC2_membrane
ABC-2 type transporter

TQCMACLWKQHLSYWRNPQYTVVRFFFSLVVALMFGTTFWQLGGKTSRKQDLFNAMGSMYAAVLFMGISYSSSVQPVVAVERTVFYRERAAGMGSMYAAGALHGDLLL

Seg: seg
163-174 seg

AAGMGSMYAAGA

Seg: seg
179-202 seg

LLLIVGAACGAGGADGLLPGAAAG

HMMPfam: PF01061
IPR013525
200-325 ABC2_membrane
ABC-2 type transporter

AAGMYSALPYAFGQVVVELPYVLVQSLAYGVIVYAMIGFEWDAKKFCWYLYFMHFTLLYFTYYGMLAVGLTPSYNIASIVSSFFYGVWNLFSGFVISRPTMPVWWRWYSWVCPVSWTLYGLVASQF

Seg: seg
352-367 seg

FLGVVAVVTAGFAVLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox