PRGDB00070028 (Hv.26252)

From PRG Wiki
Jump to: navigation, search
Hv.26252
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 13262046 (BF265266)
Gene Class Unknown
Domain Type
Gene Species Hordeum vulgare

Comment?

HV_CEa0012A13f Hordeum vulgare seedling green leaf EST library HVcDNA0004 (Blumeria challenged) Hordeum vulgare subsp. vulgare cDNA clone HV_CEa0012A13f, mRNA sequence

DNA Sequence

GATGATGCGCTGCAGATGCGTACCGGCACCCGGCGCTGCTGCTGGTGGACGGGGTGTCGTCCATCTGCGCACTGGACTTCCGCATGGACGAGTGGGGCGTGGACGTGGCGCTGACGGGGTCGCAAAAGGCGCTGTCGCTGCCGACGGGGCTGGGAATCGTGTGCGCCAGCCCCAAGGCGCTGGAGGCGGCCAAGACGGCCAAGTCGGTGCGCGTCTTCTTCGACTGGAAGGACTACCTCAAGTTCTACAAGATGGGCACCTACTGGCCCTACACGCCGTCCATCCAGCTCCTCTACGGCCTACGCGCCGGCCTCGACCTCCTCTTGGAGGAGGGCCTCGACAACGTCATCAAGAGGCACACACGCCTCGGCACCGCATCAAGGCTGGCGGTGGCAGCGTGGGGGCTCAAAAACTGCCCCGAGAAGGAGGAGAACTTCAGGAACACGGTCACCGGCGTCATGGTGCCGCCGTTCATGGACGGCAGGGAGAATCGTGAACACGCATGGAAGCGGTACAACCTCAGCCTGGGGCTCGGGCTTCACAAGGGCTGCCGGCAAGGTGTTCAGGGACGGGCAACCTTGGCCACCTGAACAGGCGTGAAGTgggggggtgacttggggggggggggAAAGGACCTCAAGGACATGGGGGGCCCAGAGAAGCTTGGGAATGTGCGAGGGGGACCACCGAGAGGTACCTGTGAAATGCCCGAACCGTAGGTCCGGACGAGAGAGGGAGAGAAGTGCGCGCCCGAGACG


Protein sequences

Name Description Sequence
Hv.26252 translated coding region predicted by ESTScan from UniGene Hv.26252

XMMRCRCVPAPGAAAGGRGVVHLRTGLPHGRVGRGRGADGVAKGAVAADGAGNRVRQPQGAGGGQDGQVGGVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLLEEGLDNVIKRHTRLGTASRLAVAAWGLKNCPEKEENFRNTVTGVMVPPFMDGRENREHAWKRYNLSLGLGLHKGCRQGVQGRATLAT

Domains

Domain Start-End Description Sequence

Seg: seg
4-21 seg

RCRCVPAPGAAAGGRGVV

Seg: seg
30-52 seg

GRVGRGRGADGVAKGAVAADGAG

Seg: seg
62-75 seg

GGGQDGQVGGVFFD

superfamily: SSF53383
IPR015424
71-182 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

GVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLLEEGLDNVIKRHTRLGTASRLAVAAWGLKNCPEKEENFRNTVTGVMVPPFMDGRENREHAWKRYNLSLGLGLHK

HMMPanther: PTHR21152:SF7
71-182 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLLEEGLDNVIKRHTRLGTASRLAVAAWGLKNCPEKEENFRNTVTGVMVPPFMDGRENREHAWKRYNLSLGLGLHK

HMMPanther: PTHR21152
71-182 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

GVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLLEEGLDNVIKRHTRLGTASRLAVAAWGLKNCPEKEENFRNTVTGVMVPPFMDGRENREHAWKRYNLSLGLGLHK

Gene3D: G3DSA:3.90.1150.10
IPR015422
88-182 no description
Pyridoxal phosphate-dependent transferase, major r

YWPYTPSIQLLYGLRAGLDLLLEEGLDNVIKRHTRLGTASRLAVAAWGLKNCPEKEENFRNTVTGVMVPPFMDGRENREHAWKRYNLSLGLGLHK

Seg: seg
97-114 seg

LLYGLRAGLDLLLEEGLD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox