PRGDB00070029 (Hv.26253)

From PRG Wiki
Jump to: navigation, search
Hv.26253
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19152398 (BM816384)
Gene Class Unknown
Domain Type
Gene Species Hordeum vulgare

Comment?

HB105B07_SK.ab1 HB Hordeum vulgare subsp. vulgare cDNA clone HB105B07_SK.ab1 similar to NADH dehydrogenase,, mRNA sequence

DNA Sequence

ACCGGGCTGCAGGAATTTCGACGAGGGTTCCACCACACAGTGAGCTCTCCTCTTCAGACCTCTCCCTTCTCCTCTCCAGGAGTCTAGGGTTagagagaggcagagagtgagagaagagCAAAAAACAACCTCTAGCCCCACTGTTGATTAATTTGCCAGCAGGCTTGTTGACAACTTCATATCTGTCTTACTTCCCTTCAATATCTTCGTATCACAATGGCTGGCCTATCCATGGAGCACCCTTGGGCATTCGCCTTCGGCCTACTGGGCAACATCATCTCTTTTACGAGCCTCCTCGCCCCGATACCAACATTCTACCGGATCTTCAAGAGCAAATCCACTGAGGGGTTCCAGTCGGTGCCCTACGTCGTGGCCCTGTTCAACGCGATGCTGTGGATCTTCTACACGCTGGTCAAGACCGGCGAGGGCCTCCTCATCACCATCAACGCTGCCGGCTGCGTCATCAAAACCGACTACATCATCATGTACCTCGTCTACACCCCCAGGAAGGCCAAGATTTTCACAGCCAAGATCGTACTCCTACTCAACGACATCGGCTTCGGGCTAATCTTACTCCTCACCCTCTTTGCCTTCCACGGTGAGACACGGGTTGTGTCACTCGGGTGGATCTGCGACNGCTACTCCGACTGTGACTTCAAAACACCTCTCAACATCATCGGACGTGTGATCAAGACCAAGAGTGTGGAGTACATGCCCTTNTGCCTNTACCTAACGCTAACCCTAANCGACGAACAAGTGTTTGCTCTACGGACTGCTTATCAAAGACAAATTCTAGACGCTCACCAACATACCTGGGCTAGACATTCCGGGATGACCCGAAATGACCTNTTACTGTTTTAAATGAACGCGCACGCCCGGATCTGGCCAAGCGATGCCAAGGAGGGGAATTAGGCCTTGGAGGGTCCCTCCAN


Protein sequences

Name Description Sequence
Hv.26253 translated coding region predicted by ESTScan from UniGene Hv.26253

MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFNAMLWIFYTLVKTGEGLLITINAAGCVIKTDYIIMYLVYTPRKAKIFTAKIVLLLNDIGFGLILLLTLFAFHGETRVVSLGWICDXYSDCDFKTPLNIIGRVIKTKSVEYMPXCLYLTLTLXDEQVFALRTAYQRQILDAHQHTWARHSGMTRNXPXTVLNERARPDLAKRCQGGELGLGGSLX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
1-176 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFNAMLWIFYTLVKTGEGLLITINAAGCVIKTDYIIMYLVYTPRKAKIFTAKIVLLLNDIGFGLILLLTLFAFHGETRVVSLGWICDXYSDCDFKTPLNIIGRVIKTKSVEYMPXCLYLTLTL

HMMPfam: PF03083
IPR004316
13-98 MtN3_slv
RAG1-activating protein-1-related

AFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFNAMLWIFYTLVKTGEGLLITINAAGCVIKTDYIIMYLVYTPRK

Seg: seg
113-124 seg

IGFGLILLLTLF

HMMPfam: PF03083
IPR004316
134-176 MtN3_slv
RAG1-activating protein-1-related

SLGWICDXYSDCDFKTPLNIIGRVIKTKSVEYMPXCLYLTLTL

Seg: seg
229-239 seg

GGELGLGGSLX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox