PRGDB00070030 (Hv.26272)

From PRG Wiki
Jump to: navigation, search
Hv.26272
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151418491 (AK249842)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf58k02, mRNA sequence

DNA Sequence

GAGAGGTAGACACCACCACCACACCCGGCAAAACAGTAAGCACAAAAGGTTGTTGTGCTGCGCGCTCCGGCTGAGCAAAGGTGCGTTATTATCTCTCGTGCTGATTACTACCAGCAGTAGTACTTTAGCAATTATCTATTTTGTGCTTCGGCCTGTTTTGTCAGGCTTGTCATCATACTTGTATTTTCAAACGTCGCTTGTCATGTTTATTTCAATGAAGAGTGAACATCTGACAGAGTAACACGTTTGTGCTCTGAACTAGTACTATGAGTTTGCGTTCTTAGTTTTTCCGGCGAATACATAATGTGCAAAGATGTTCGTGACAAATTTTGTTGATTTCTTTTCCCGGACGCAAACTCTGGTATTTGCTGCTCTTCCCTTAAAGAAGGAAGTGCTCTTATCTCGGTTCATCCTTGGTGTGTAAGAGCGAGGCGGTTTACAATGATGTATGAATGCGATATAGTCTTAGTTTGTTGGAGATTGGTATATTAAAAATGCATATGCCTTACCTTTGCAGGCAGCGTAGATCTAATGGCTGCTCGGCGATCCTTGAACCTCACCTCGCTTGTTTTAACGTCACTATTATTGCTGTTTTATGGAGCTGGCAATGCCGATTGCTTTGTCACTCATAATAACAGCACGGAGAGACGTTCACTGCTTGATTTTAAGGACGCCATCACACAAGATCCGACAGGAATCTTCAGCTCCTGGAATGACAGCATTCAGTACTGTATGTGGCCAGGCGTCAACTGCAGCCTGAAGCACCCGGGGCGCGTTACAGCGTTGAACCTCGAAAGCCTGAAGTTGGCAGGACAAATATCACCATCTCTGGGAAACCTAACCTTCCTTAGACAACTTTTACTAGGCACCAACTTATTACAGGGTAGTATTCCAGAAACACTTACAAATTGTTCCAAACTCGTGGTGCTAAACCTCGCTGTTAACATGCTAGTGGGTTCAATTCCACGAAACATAGGTTTCCTCAGCAATCTACAATTTATGGACCTTTCCAACAATACACTCACAGGAAACATTCCGTCAACCATTAGCAACATCACTCACTTGACACAAATATCACTTGCAGCAAATCAACTCGAGGGAAGCATTCCCGAAGAGTTTGGGCAATTGACGTATATTGAGCGGGTGTATCTGGGTGGCAATGGACTAACAGGGAGAGTTCCAATAGCACTCTTCAATCTATCCTATCTTCAAATACTAGACCTGAGTATAAATATGTTAAGCGGCAGATTGCCATCTGAAATTACTGGTGATATGATGCTTAACCTCCAATTTCTTTTACTGGGTAACAACAAGTTTGAAGGTGACATTCCAGGTTCACTGGGCAATGCTTCACAGCTAACACGGGTAGATTTTTCATTAAATAGTTTTACCGGTCTTATTCCTAGTTCTTTGGGTAAACTTAATTATTTAGAGTATCTAAACCTCGATCAAAACAAGCTTGAAGCAAGGGACAGCCAAAGCTGGGAATTTTTAAGTGCGCTGAGCACTTGTCCTCTACCAACACTCACATTATATGGAAATCAATTACATGGAGTTATACCAAATTCTCTTGGTAACCTATCCATCACGCTTGAACAACTAAATTTAGGTGCAAACAACTTGTCCGGGGTGGTTCCCCCGGGCATAGGAAAATACCACAACTTATTTAGCCTAACGCTAAGCTACAATAATCTTACTGGCACAATTGAAAAATGGATCGGGACCCTCAAGAATCTACAAGGGTTGGATCTTGAAGGAAATAACTTCAATGGATCAATACCGTACTCCATTGGCAATCTGACAAAGTTGATATCCCTCGATATTTCCAAAAATCAATTTGATGGTGTCATGCCAACCAGCATGGGAAGTTTTCGACAACTCACACATTTAGATCTTAGTTATAACAACATCCAAGGTAGCATACCTCTGCAGGTTTCTAACCTTAAAACACTCACAGAACTACATCTTTCATCCAACAAGCTTACCGGAGAAATACCCAAAAATTTGGATCAATGCTATAATTTGATAACTATACAAATGGACCAGAATATGCTAATAGGGAATATTCCGACATCTTTTGGCAATCTAAAGGTCTTAAACATGCTCAATCTTTCCCACAATAACTTGTCGGGCACCATCCCGTTAGACCTTAATGAGCTTCAACAACTCCGAACGCTAGACTTATCATATAACCATCTGAAAGGGGAAATACCGAGAAATGGTGTATTTGAAGATGCTGCAGGCATTTCACTTGATGGAAATTGGGGGCTTTGCGGAGGAGCACCAAACCTACATATGTCTTCATGCCTTGTTGGTTCTCAGAAATCACGAAGACAATATTATTTAGTCAAAATATTGATCCCAATATTTGGCTTTATGTCGTTGGCCCTACTGATAGTTTTTATACTCACTGAGAAGAAGAGAAGAAGGAAGTATACATCACAGCTTCCTTTTGGAAAGGAATTTCTCAAAGTATCTCACAAGGATCTGGAAGAAGCCACAGAAAACTTCTCGGAGTCCAACTTGATTGGAAAAGGAAGCTGCGGTTCAGTATACAAAGGAAAGTTAGGCCACAACAAAATGGAAGTGGCAGTGAAAGTTTTTGACCTTGGGATGCATGGCGCTGAAAAAAGTTTCTTAGCAGAATGTGAAGCAGTTAGAAACATTCAGCATCGAAATCTTCTCCCAATCATAACGGTGTGTTCAACTGCTGACACCACCGGCAATGCTTTCAAAGCTCTAGTTTATGAGTTGATGCCTAATGGGAATTTGGAGACTTGGTTGCATCACAATGGGGACGGGAAAGATAGAAAACCTCTGGGCTTCGTGAAAAGGATAAGCATAGCTCTTAACATAGCTGATGTATTGCACTATTTGCACCATGATATTGGAACTCCAATCATCCATTGTGACTTGAAACCCAGTAATATTCTCCTAGACCATGATATGATTGCTTACCTGGGAGACTTCGGGATTGCAAGATTTTTCCGTGATTCAAGGTTGACATCAAGAGGAGAGTCTAGTTCCAATGGTCTGAGGGGTACTATAGGGTATATCCCTCCAGAGTATGCTGGAGGTGGCCGCCCATCTACTTGTGGAGATGCATATAGTTTCGGGGTTCTACTCCTGGAGATGCTTACAGGCAAAAGACCAACAGATTCTATGTTTGGAAATGGAGTTAACATTATCAATTTCGTCGACAAGAACTTCCCAGAAAAACTATTTGACATCATCGATATTCCTCTCCAAGAAGAATGCAAGGCTTATACTACTCCAGGAAAGATGGTAACAGAAAACATGGTCTACCAATGCTTACTTTCTCTAGTACAAGTAGCACTTTCTTGTACACGTGAGATCCCAAGTGAGCGTATGAACATGAAAGAAGCAGGCACCAGGTTGAGCGGCACCAATGCATCATACCTCGCAGGAAAAGATAAATATGCTTCTTAGAGAGATTTAACTAAACCTCGGACATGTACGCGTATGTGTAGGTGTAGCAAAGATATGTACTTTTTGTTTATATTAAATTGATAGCAAAGTGTGTACTTGTGTGTACATCCGTGCACGAGGCCAAAAATCATCATAGTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.26272 translated coding region predicted by ESTScan from UniGene Hv.26272

MHMPYLCRQRRSNGCSAILEPHLACFNVTIIAVYGAGNADCFVTHNNSTERRSLLDFKDAITQDPTGIFSSWNDSIQYCMWPGVNCSLKHPGRVTALNLESLKLAGQISPSLGNLTFLRQLLLGTNLLQGSIPETLTNCSKLVVLNLAVNMLVGSIPRNIGFLSNLQFMDLSNNTLTGNIPSTISNITHLTQISLAANQLEGSIPEEFGQLTYIERVYLGGNGLTGRVPIALFNLSYLQILDLSINMLSGRLPSEITGDMMLNLQFLLLGNNKFEGDIPGSLGNASQLTRVDFSLNSFTGLIPSSLGKLNYLEYLNLDQNKLEARDSQSWEFLSALSTCPLPTLTLYGNQLHGVIPNSLGNLSITLEQLNLGANNLSGVVPPGIGKYHNLFSLTLSYNNLTGTIEKWIGTLKNLQGLDLEGNNFNGSIPYSIGNLTKLISLDISKNQFDGVMPTSMGSFRQLTHLDLSYNNIQGSIPLQVSNLKTLTELHLSSNKLTGEIPKNLDQCYNLITIQMDQNMLIGNIPTSFGNLKVLNMLNLSHNNLSGTIPLDLNELQQLRTLDLSYNHLKGEIPRNGVFEDAAGISLDGNWGLCGGAPNLHMSSCLVGSQKSRRQYYLVKILIPIFGFMSLALLIVFILTEKKRRRKYTSQLPFGKEFLKVSHKDLEEATENFSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRLSGTNASYLAGKDKYAS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
8-969 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RQRRSNGCSAILEPHLACFNVTIIAVYGAGNADCFVTHNNSTERRSLLDFKDAITQDPTGIFSSWNDSIQYCMWPGVNCSLKHPGRVTALNLESLKLAGQISPSLGNLTFLRQLLLGTNLLQGSIPETLTNCSKLVVLNLAVNMLVGSIPRNIGFLSNLQFMDLSNNTLTGNIPSTISNITHLTQISLAANQLEGSIPEEFGQLTYIERVYLGGNGLTGRVPIALFNLSYLQILDLSINMLSGRLPSEITGDMMLNLQFLLLGNNKFEGDIPGSLGNASQLTRVDFSLNSFTGLIPSSLGKLNYLEYLNLDQNKLEARDSQSWEFLSALSTCPLPTLTLYGNQLHGVIPNSLGNLSITLEQLNLGANNLSGVVPPGIGKYHNLFSLTLSYNNLTGTIEKWIGTLKNLQGLDLEGNNFNGSIPYSIGNLTKLISLDISKNQFDGVMPTSMGSFRQLTHLDLSYNNIQGSIPLQVSNLKTLTELHLSSNKLTGEIPKNLDQCYNLITIQMDQNMLIGNIPTSFGNLKVLNMLNLSHNNLSGTIPLDLNELQQLRTLDLSYNHLKGEIPRNGVFEDAAGISLDGNWGLCGGAPNLHMSSCLVGSQKSRRQYYLVKILIPIFGFMSLALLIVFILTEKKRRRKYTSQLPFGKEFLKVSHKDLEEATENFSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRLS

HMMPanther: PTHR24420
8-969 FAMILY NOT NAMED,FAMILY NOT NAMED

RQRRSNGCSAILEPHLACFNVTIIAVYGAGNADCFVTHNNSTERRSLLDFKDAITQDPTGIFSSWNDSIQYCMWPGVNCSLKHPGRVTALNLESLKLAGQISPSLGNLTFLRQLLLGTNLLQGSIPETLTNCSKLVVLNLAVNMLVGSIPRNIGFLSNLQFMDLSNNTLTGNIPSTISNITHLTQISLAANQLEGSIPEEFGQLTYIERVYLGGNGLTGRVPIALFNLSYLQILDLSINMLSGRLPSEITGDMMLNLQFLLLGNNKFEGDIPGSLGNASQLTRVDFSLNSFTGLIPSSLGKLNYLEYLNLDQNKLEARDSQSWEFLSALSTCPLPTLTLYGNQLHGVIPNSLGNLSITLEQLNLGANNLSGVVPPGIGKYHNLFSLTLSYNNLTGTIEKWIGTLKNLQGLDLEGNNFNGSIPYSIGNLTKLISLDISKNQFDGVMPTSMGSFRQLTHLDLSYNNIQGSIPLQVSNLKTLTELHLSSNKLTGEIPKNLDQCYNLITIQMDQNMLIGNIPTSFGNLKVLNMLNLSHNNLSGTIPLDLNELQQLRTLDLSYNHLKGEIPRNGVFEDAAGISLDGNWGLCGGAPNLHMSSCLVGSQKSRRQYYLVKILIPIFGFMSLALLIVFILTEKKRRRKYTSQLPFGKEFLKVSHKDLEEATENFSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRLS

superfamily: SSF52058
44-341 L domain-like,LRR

THNNSTERRSLLDFKDAITQDPTGIFSSWNDSIQYCMWPGVNCSLKHPGRVTALNLESLKLAGQISPSLGNLTFLRQLLLGTNLLQGSIPETLTNCSKLVVLNLAVNMLVGSIPRNIGFLSNLQFMDLSNNTLTGNIPSTISNITHLTQISLAANQLEGSIPEEFGQLTYIERVYLGGNGLTGRVPIALFNLSYLQILDLSINMLSGRLPSEITGDMMLNLQFLLLGNNKFEGDIPGSLGNASQLTRVDFSLNSFTGLIPSSLGKLNYLEYLNLDQNKLEARDSQSWEFLSALSTCPL

HMMPfam: PF08263
IPR013210
48-87 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

STERRSLLDFKDAITQDPTGIFSSWNDSIQYCMWPGVNCS

Gene3D: G3DSA:3.80.10.10
49-337 no description

TERRSLLDFKDAITQDPTGIFSSWNDSIQYCMWPGVNCSLKHPGRVTALNLESLKLAGQISPSLGNLTFLRQLLLGTNLLQGSIPETLTNCSKLVVLNLAVNMLVGSIPRNIGFLSNLQFMDLSNNTLTGNIPSTISNITHLTQISLAANQLEGSIPEEFGQLTYIERVYLGGNGLTGRVPIALFNLSYLQILDLSINMLSGRLPSEITGDMMLNLQFLLLGNNKFEGDIPGSLGNASQLTRVDFSLNSFTGLIPSSLGKLNYLEYLNLDQNKLEARDSQSWEFLSALS

ProfileScan: PS51450
IPR001611
98-119 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLESLKLAGQISPSLGNLTFLR

Seg: seg
112-129 seg

LGNLTFLRQLLLGTNLLQ

HMMSmart: SM00369
IPR003591
115-139 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLRQLLLGTNLLQGSIPETLTNC

ProfileScan: PS51450
IPR001611
141-164 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLVVLNLAVNMLVGSIPRNIGFLS

Seg: seg
142-153 seg

LVVLNLAVNMLV

HMMSmart: SM00369
IPR003591
163-187 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLQFMDLSNNTLTGNIPSTISNI

ProfileScan: PS51450
IPR001611
165-187 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQFMDLSNNTLTGNIPSTISNI

HMMPfam: PF00560
IPR001611
165-186 LRR_1
Leucine-rich repeat

NLQFMDLSNNTLTGNIPSTISN

ProfileScan: PS51450
IPR001611
189-211 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTQISLAANQLEGSIPEEFGQL

HMMSmart: SM00369
IPR003591
235-259 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSYLQILDLSINMLSGRLPSEITGD

ProfileScan: PS51450
IPR001611
237-259 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLQILDLSINMLSGRLPSEITGD

HMMSmart: SM00369
IPR003591
261-285 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MLNLQFLLLGNNKFEGDIPGSLGNA

ProfileScan: PS51450
IPR001611
263-285 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQFLLLGNNKFEGDIPGSLGNA

ProfileScan: PS51450
IPR001611
311-334 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLEYLNLDQNKLEARDSQSWEFLS

Gene3D: G3DSA:3.80.10.10
343-574 no description

TLTLYGNQLHGVIPNSLGNLSITLEQLNLGANNLSGVVPPGIGKYHNLFSLTLSYNNLTGTIEKWIGTLKNLQGLDLEGNNFNGSIPYSIGNLTKLISLDISKNQFDGVMPTSMGSFRQLTHLDLSYNNIQGSIPLQVSNLKTLTELHLSSNKLTGEIPKNLDQCYNLITIQMDQNMLIGNIPTSFGNLKVLNMLNLSHNNLSGTIPLDLNELQQLRTLDLSYNHLKGEIPR

superfamily: SSF52058
343-594 L domain-like,LRR

TLTLYGNQLHGVIPNSLGNLSITLEQLNLGANNLSGVVPPGIGKYHNLFSLTLSYNNLTGTIEKWIGTLKNLQGLDLEGNNFNGSIPYSIGNLTKLISLDISKNQFDGVMPTSMGSFRQLTHLDLSYNNIQGSIPLQVSNLKTLTELHLSSNKLTGEIPKNLDQCYNLITIQMDQNMLIGNIPTSFGNLKVLNMLNLSHNNLSGTIPLDLNELQQLRTLDLSYNHLKGEIPRNGVFEDAAGISLDGNWGLCG

ProfileScan: PS51450
IPR001611
365-386 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEQLNLGANNLSGVVPPGIGK

ProfileScan: PS51450
IPR001611
389-411 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFSLTLSYNNLTGTIEKWIGTL

HMMSmart: SM00369
IPR003591
411-435 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLQGLDLEGNNFNGSIPYSIGNL

ProfileScan: PS51450
IPR001611
413-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQGLDLEGNNFNGSIPYSIGNLT

HMMPfam: PF13855
413-472 LRR_8,Leucine rich repeat

NLQGLDLEGNNFNGSIPYSIGNLTKLISLDISKNQFDGVMPTSMGSFRQLTHLDLSYNNI

HMMSmart: SM00369
IPR003591
459-482 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FRQLTHLDLSYNNIQGSIPLQVSN

ProfileScan: PS51450
IPR001611
461-484 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLTHLDLSYNNIQGSIPLQVSNLK

FPrintScan: PR00019
462-475 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSYNNIQGS

HMMSmart: SM00369
IPR003591
483-507 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKTLTELHLSSNKLTGEIPKNLDQC

HMMPfam: PF13516
483-504 LRR_6,Leucine Rich repeat

LKTLTELHLSSNKLTGEIPKNL

ProfileScan: PS51450
IPR001611
485-507 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLTELHLSSNKLTGEIPKNLDQC

HMMPfam: PF13855
509-568 LRR_8,Leucine rich repeat

NLITIQMDQNMLIGNIPTSFGNLKVLNMLNLSHNNLSGTIPLDLNELQQLRTLDLSYNHL

ProfileScan: PS51450
IPR001611
533-556 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLNMLNLSHNNLSGTIPLDLNELQ

Seg: seg
534-545 seg

LNMLNLSHNNLS

FPrintScan: PR00019
555-568 LEURICHRPT,Leucine-rich repeat signature

LQQLRTLDLSYNHL

HMMSmart: SM00369
IPR003591
555-580 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQQLRTLDLSYNHLKGEIPRNGVFED

ProfileScan: PS51450
IPR001611
557-579 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRTLDLSYNHLKGEIPRNGVFE

Gene3D: G3DSA:3.30.200.20
631-754 no description

ALLIVFILTEKKRRRKYTSQLPFGKEFLKVSHKDLEEATENFSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELM

superfamily: SSF56112
IPR011009
642-968 Protein kinase-like (PK-like)
Protein kinase-like domain

KRRRKYTSQLPFGKEFLKVSHKDLEEATENFSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRL

ProfileScan: PS50011
IPR000719
672-976 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRLSGTNASYL

HMMSmart: SM00219
IPR020635
672-968 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRL

HMMSmart: SM00220
IPR002290
672-976 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSESNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRLSGTNASYL

HMMPfam: PF00069
IPR017442
675-897 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNLIGKGSCGSVYKGKLGHNKMEVAVKVFDLGMHGAEKSFLAECEAVRNIQHRNLLPIITVCSTADTTGNAFKALVYELMPNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNI

Gene3D: G3DSA:1.10.510.10
755-968 no description

PNGNLETWLHHNGDGKDRKPLGFVKRISIALNIADVLHYLHHDIGTPIIHCDLKPSNILLDHDMIAYLGDFGIARFFRDSRLTSRGESSSNGLRGTIGYIPPEYAGGGRPSTCGDAYSFGVLLLEMLTGKRPTDSMFGNGVNIINFVDKNFPEKLFDIIDIPLQEECKAYTTPGKMVTENMVYQCLLSLVQVALSCTREIPSERMNMKEAGTRL

PatternScan: PS00108
IPR008271
802-814 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox