PRGDB00070031 (Hv.26279)

From PRG Wiki
Jump to: navigation, search
Hv.26279
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151426974 (AK249023)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf17p21, mRNA sequence

DNA Sequence

GGAAAGGTAAGCATACAGACATCATACCGGCAAAGCCAAGCCGCGGATGCTGTGCACTCCTTGCAGAGCAGAGGTAACACGTACGCGGCTAATGCCTGACTGAGCACTCCGTGAAGAAACTCACTCACCTACATCAGTATGGTTGTCCTACTGGCGTTTCTGCTGCTGCTGCTGTCCTATGGAGCTGGCAACATCCATTGCTCAACAGTCAGTCACGAAAACAGAACAGACGTGCACTCGTTGCTCGAGTTCAAAGCGGCTACCAACGACCCAACAGGTGCCCTAAGATCTTGGAACAGGCGTGTCCACTACTGCAACTGGACGGGCGTCAGATGCAGCTCACTGAAACCGGAGCGCGTCGTTGCTCTGAGACTCCCCGGCCAAAGCTTGTCAGGCGAGATCAGCCCCTCTTTTGGGAACTTGACGTACCTTAAGGTCCTCGATTTGTCCTCCAATGGCTTCTCCGGCCTGTTACCTCCTATGAACCTGCTCCATGAGCTGGTCCACCTTGACCTGAGCTTCAATTCGTTTCAGGGGACGATTCCTGACTCACTCATGAATTGCTCCAACCTACACTATCTAGTTCTTTCTGGAAACATGCTACAAGGTCCAATCCCCAAGAAAATTGGTTCGCTCTATAATCTATTAGGCTTAGGCCTTGCTAGGAATAATCTTACCGGGGTCATCCCACCAACCATCAGCAACGCCACCCAGTTAGAACAACTCGATCTTGGGGAAAATGAACTAGGGGGGAGCATTCCTGATGTGTTTGGGCAATGGCCCAAGATGTTGGAATTGTCCGTAGGTGAAAATAGGCTCTCAGGTCGAATACCACCATCCTTCTTTAATCTGACTTCGGTTCAAATATTAGGCTTGTATGCAAATAAGCTACAAGGGGAATTGCCTCCTGACATTGGCGATACCCTCCCTGAAAACATACTTTTTTCGCTGGGCGAGAACATGCTTCATGGTCACATCCCAGCTTCGCTAGGCAACGCTTCACGGCTACAACTCATGGATTTATCAGATAACAGCTTCGTTGGAGAAATTCCTATTTTCGGAAAGCTACCAAACCTTGAGAACTTAAACCTTGGATATAATATGCTTGAATCAAGTGAAAGCCAAAGATGGGAATCCTTGTATGGACTAACAAACTGTAGTAATCTATATGCGCTCACATTAGATAATAATCAGCTGCAAGGAGCCATACCGGATTTGGTCGGTAAGTTGTCCACTAAACTCACACGTCTACACATGAATGGAAACAATCTATCAGGAATAGTTCCTTTAAGCCTAGCAAACCGTAGTAGCATAATCGATTTGGATCTTAGCAACAACAGCTTAACTGGTAAAATTGAAGGATGGTTAGGGAGTCTAATAAACTTACAATATTTAGATCTTCATGGAAACAATTTCGCCGGGTCCATTCCACCATCTTTTGGCAACCTTTCAGAACTGACAATACTTTCTCTAGCACAAAATGAATTTGAAGGTCCCATACCTCCCACATTGGGAAAACTTTCACAACTCTCAAGGCTGGACCTTAGCTATAATAATCTGCAAGGTGAGATACCTCCAGAAATTAGTGAGCTTAAACAACTCATTTCACTATATCTATCTTCTAGCAGACTTTCGGGAAAAATTCCCGATGATCTGGGCAAGTGTCAGGGCCTCATAACCATCCAAATGGACCACAATAATCTCACCGGTGTCATTCCAACCTCTTTAGGCAACCTTTTGAGCTTGGACATGCTCAACCTGTCCTATAATGATTTGTCAGGTGTCATCCCAACAGTACTAAGTGATCTTCAACTTCTTAGCAAGTTAGACCTATCTTATAATCGTCTCCGAGGAGCAATCCCAAGAAATGGAGTGTTTGAGCACCCCGCAAACGTTTCCCTTGATGGCAACTCGGGACTTTGCGGACAAGCAACCGGTTTCCATGTGCCCTCATGCCCAGATGCCTCGCCGAGAACAGGAAGACACTATCGTTTGATTACGGTGTTGATCACAATAATTGGTTTCCTGTCATTGGCACTGTTGACTTGCTTTATAATCCACGAGAAGATACCACAGGCAACATTTTCGTTGCTGCCTTCTCTCGGGGAGAAATTCCCTAGAGTTTCTTACTGGGATCTAGCTCGAGCGACAAGCAACTTCTCTGAGATTAACTTGATTGGCGAAGGAAGTTACAGCTCAGTGTACAAAGGAAAGTTGAAACAAGTTAAAACAGAAATAGCGATCAAGATACTTGACCTTGAGATTCCGGGTGCCGAAGGAAGTTTTGCATTAGAATGCAAAGCATTGAGAGGCATTCGTCATAGAAACATTGTTCCCCTCATAACTGAATGCTCCGCAATCGACAACAAAGGCAATGCTTTCAGAGCTATCATCTATGCTTTCATGCCCAATGGGAACTTGGACACTTGGTTGCATCATCAAGGGAATCAGGCAGCTGGAAGGCATTTAGGCTTGGCTCAAAGAATAAGCATCGCTACTAACATAGCCGACGCATTGGACTATTTGCACCATTATAGTGGGAGGCCCATCATCCATTGTGATTTGAAGCCGAGTAACATACTCCTAGACATTCATATGAATGCTTGTCTAGGAGATTTTGGCATCGCGAGGTTCTACATTGATTCTAAACTGAGAACAGTCGGTGATTCAAGTTCAATTACTGTGAACGGAACTCTCGGATACATGGCTCCAGGTATAGTTGTTTGACAAATGATTAGTTTTTCTAAGTGTTTTGCATATAATTATTTACCGCTTCCATGATTACTGATTTGGTCTCTGTTTTTAGAGTATGCTGAAAACGGTCACGCATCTACTTGTGGGGACGTATATAGTTTCGGAATAGTACTTTTGGAGATGCTGACAGGAAAAAGACCAACGGATGATATGTTCAGGAACGAACTCACCATTGTCAGATTTGTGGAAACGAATTTTCCTGATCACACATTAAATTTTCTGGATTCTCGTCTGGTAAATGAATGCAATGGTGGCATCGACCAAATAGCAGCAGGAACGGAAAACCCGCCGATCTTTCAGTCCTTGTTATCTTTGCTACGAGTAGCACTTCAGTGTACACGCCAATCCCCAACTGAACGGCTTAACATGAGAGAAGTAGCTACCCAATTGTGCAAAATCAACATGGTGAACACGGGAAGGAGAGTTAGGAGCTCAACTTCTTTTAGGAGACTTGTCAGCTGGGCTTCTCAAAGGAGCTAAAGAAGAAATGGAGGTGCAATTAGAGTCTGTTGATAAAATGGTCCCTGCTAAGAATGTAATGTAATACACTTTATACTCCAGCTTGCATGTCCTTTTTGGATTAATATCCTATTCTGGGTCCAGCAATCATCTTCTATTTTTCCTTCTTCTACCATTGGCAATTTTATGGAAGTACCCAATATTGTTGTCTACTTTATGGAGTCAATTATCACTGGATCTTCTATGCCATTATTCCTCCTATTCCAGTCGTTCACACATATTACTCTAAATGAAACTTCTTCTTTTTTTGGTGATGACTAAATGAAACTTCATCTAGCCATCTGTTCATTTGCCGGTTGTTGTATCTCTTCCAAGTCCTTTAGATCCTTCAATTCATCCATTAGTTCAGCTCTGCTTTAACACTTGCTTTCTTATGTTTCTACCACGGCCTTTCAAGTATCTACTAGCCATCAAGCTTCTTCTTTTTTTGCATAACTGTCCTTGGCAACCTTCTGAAAGAAATACTCCCTGAGTAGCCAAAATAGCTCTCTAAAGGATTTGTGATTTGGCTCCTTCTGTGCCATGATATCAAGGATCAAAGGATCATGACCATATATTAGTCTAGAGAGCTTGCGTACAAAACTAAATAAAAAGGTTCTCCCAACCATTACTCATTAGGAGTCTTTCAACTTTTTTTCCAAGGAAGGGTTCTCGTGATTATTAGACTAGGTGAAAGTACCCCGAGACATAACGGCCTATGGAGACGAAAGAGTGGAAGAGTGCAGGAGTGGCCTCCTGACTGCTAATCTGTTCGTATCAATAGTTGAGTTTATTCTCAAGCTTTTAATCATTGTTGAGCAGAACTAAACTAGACACCAAAGTTGAAGCCGAAGTGTGTTTCGCCTTTCATCGGATGGGGTGGGTCGTTCATCAAGGAATTTAAACAGCGTCTCCGTGGGTACATGTAGCCGCGGAAGACACGAAAGTGTGTTTCTGGTCGCGAGTTCAAATGCATCTGCAATAAAGTTTCTCAAAACAAATTAACAAAAACGAGAAAACTGAttttgtttttttcaataaacattgaccttttttgcaataaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.26279 translated coding region predicted by ESTScan from UniGene Hv.26279

XKGKHTDIIPAKPSRGCCALLAEQRXHVRGXCLTEHSVKKLTHLHQYGCPTGVSAAAAVLWSWQHPLLNSQSRKQNRRALVARVQSGYQRPNRCPKILEQACPLLQLDGRQMQLTETGAVVALRLPGQSLSGEISPSFGNLTYLKVLDLSSNGFSGLLPPMNLLHELVHLDLSFNSFQGTIPDSLMNCSNLHYLVLSGNMLQGPIPKKIGSLYNLLGLGLARNNLTGVIPPTISNATQLEQLDLGENELGGSIPDVFGQWPKMLELSVGENRLSGRIPPSFFNLTSVQILGLYANKLQGELPPDIGDTLPENILFSLGENMLHGHIPASLGNASRLQLMDLSDNSFVGEIPIFGKLPNLENLNLGYNMLESSESQRWESLYGLTNCSNLYALTLDNNQLQGAIPDLVGKLSTKLTRLHMNGNNLSGIVPLSLANRSSIIDLDLSNNSLTGKIEGWLGSLINLQYLDLHGNNFAGSIPPSFGNLSELTILSLAQNEFEGPIPPTLGKLSQLSRLDLSYNNLQGEIPPEISELKQLISLYLSSSRLSGKIPDDLGKCQGLITIQMDHNNLTGVIPTSLGNLLSLDMLNLSYNDLSGVIPTVLSDLQLLSKLDLSYNRLRGAIPRNGVFEHPANVSLDGNSGLCGQATGFHVPSCPDASPRTGRHYRLITVLITIIGFLSLALLTCFIIHEKIPQATFSLLPSLGEKFPRVSYWDLARATSNFSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQLCKINMVNREGELGAQLLLGDLSAGLLKGAKEEMEVQLESVDKMVPAKNVM

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
70-379 L domain-like,LRR

SQSRKQNRRALVARVQSGYQRPNRCPKILEQACPLLQLDGRQMQLTETGAVVALRLPGQSLSGEISPSFGNLTYLKVLDLSSNGFSGLLPPMNLLHELVHLDLSFNSFQGTIPDSLMNCSNLHYLVLSGNMLQGPIPKKIGSLYNLLGLGLARNNLTGVIPPTISNATQLEQLDLGENELGGSIPDVFGQWPKMLELSVGENRLSGRIPPSFFNLTSVQILGLYANKLQGELPPDIGDTLPENILFSLGENMLHGHIPASLGNASRLQLMDLSDNSFVGEIPIFGKLPNLENLNLGYNMLESSESQRWES

Gene3D: G3DSA:3.80.10.10
115-292 no description

TETGAVVALRLPGQSLSGEISPSFGNLTYLKVLDLSSNGFSGLLPPMNLLHELVHLDLSFNSFQGTIPDSLMNCSNLHYLVLSGNMLQGPIPKKIGSLYNLLGLGLARNNLTGVIPPTISNATQLEQLDLGENELGGSIPDVFGQWPKMLELSVGENRLSGRIPPSFFNLTSVQILGL

HMMPanther: PTHR24420:SF474
120-1051 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VVALRLPGQSLSGEISPSFGNLTYLKVLDLSSNGFSGLLPPMNLLHELVHLDLSFNSFQGTIPDSLMNCSNLHYLVLSGNMLQGPIPKKIGSLYNLLGLGLARNNLTGVIPPTISNATQLEQLDLGENELGGSIPDVFGQWPKMLELSVGENRLSGRIPPSFFNLTSVQILGLYANKLQGELPPDIGDTLPENILFSLGENMLHGHIPASLGNASRLQLMDLSDNSFVGEIPIFGKLPNLENLNLGYNMLESSESQRWESLYGLTNCSNLYALTLDNNQLQGAIPDLVGKLSTKLTRLHMNGNNLSGIVPLSLANRSSIIDLDLSNNSLTGKIEGWLGSLINLQYLDLHGNNFAGSIPPSFGNLSELTILSLAQNEFEGPIPPTLGKLSQLSRLDLSYNNLQGEIPPEISELKQLISLYLSSSRLSGKIPDDLGKCQGLITIQMDHNNLTGVIPTSLGNLLSLDMLNLSYNDLSGVIPTVLSDLQLLSKLDLSYNRLRGAIPRNGVFEHPANVSLDGNSGLCGQATGFHVPSCPDASPRTGRHYRLITVLITIIGFLSLALLTCFIIHEKIPQATFSLLPSLGEKFPRVSYWDLARATSNFSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQLCKI

HMMPanther: PTHR24420
120-1051 FAMILY NOT NAMED,FAMILY NOT NAMED

VVALRLPGQSLSGEISPSFGNLTYLKVLDLSSNGFSGLLPPMNLLHELVHLDLSFNSFQGTIPDSLMNCSNLHYLVLSGNMLQGPIPKKIGSLYNLLGLGLARNNLTGVIPPTISNATQLEQLDLGENELGGSIPDVFGQWPKMLELSVGENRLSGRIPPSFFNLTSVQILGLYANKLQGELPPDIGDTLPENILFSLGENMLHGHIPASLGNASRLQLMDLSDNSFVGEIPIFGKLPNLENLNLGYNMLESSESQRWESLYGLTNCSNLYALTLDNNQLQGAIPDLVGKLSTKLTRLHMNGNNLSGIVPLSLANRSSIIDLDLSNNSLTGKIEGWLGSLINLQYLDLHGNNFAGSIPPSFGNLSELTILSLAQNEFEGPIPPTLGKLSQLSRLDLSYNNLQGEIPPEISELKQLISLYLSSSRLSGKIPDDLGKCQGLITIQMDHNNLTGVIPTSLGNLLSLDMLNLSYNDLSGVIPTVLSDLQLLSKLDLSYNRLRGAIPRNGVFEHPANVSLDGNSGLCGQATGFHVPSCPDASPRTGRHYRLITVLITIIGFLSLALLTCFIIHEKIPQATFSLLPSLGEKFPRVSYWDLARATSNFSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQLCKI

HMMPfam: PF13504
142-157 LRR_7,Leucine rich repeat

TYLKVLDLSSNGFSGL

HMMSmart: SM00369
IPR003591
164-188 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHELVHLDLSFNSFQGTIPDSLMNC

HMMPfam: PF00560
IPR001611
167-188 LRR_1
Leucine-rich repeat

LVHLDLSFNSFQGTIPDSLMNC

Seg: seg
210-227 seg

GSLYNLLGLGLARNNLTG

HMMSmart: SM00369
IPR003591
212-236 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYNLLGLGLARNNLTGVIPPTISNA

HMMSmart: SM00369
IPR003591
284-308 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSVQILGLYANKLQGELPPDIGDT

Gene3D: G3DSA:3.80.10.10
293-392 no description

YANKLQGELPPDIGDTLPENILFSLGENMLHGHIPASLGNASRLQLMDLSDNSFVGEIPIFGKLPNLENLNLGYNMLESSESQRWESLYGLTNCSNLYAL

HMMPfam: PF13516
356-370 LRR_6,Leucine Rich repeat

LPNLENLNLGYNMLE

HMMSmart: SM00369
IPR003591
356-379 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLENLNLGYNMLESSESQRWES

superfamily: SSF52058
383-642 L domain-like,LRR

LTNCSNLYALTLDNNQLQGAIPDLVGKLSTKLTRLHMNGNNLSGIVPLSLANRSSIIDLDLSNNSLTGKIEGWLGSLINLQYLDLHGNNFAGSIPPSFGNLSELTILSLAQNEFEGPIPPTLGKLSQLSRLDLSYNNLQGEIPPEISELKQLISLYLSSSRLSGKIPDDLGKCQGLITIQMDHNNLTGVIPTSLGNLLSLDMLNLSYNDLSGVIPTVLSDLQLLSKLDLSYNRLRGAIPRNGVFEHPANVSLDGNSGLCG

Gene3D: G3DSA:3.80.10.10
393-642 no description

TLDNNQLQGAIPDLVGKLSTKLTRLHMNGNNLSGIVPLSLANRSSIIDLDLSNNSLTGKIEGWLGSLINLQYLDLHGNNFAGSIPPSFGNLSELTILSLAQNEFEGPIPPTLGKLSQLSRLDLSYNNLQGEIPPEISELKQLISLYLSSSRLSGKIPDDLGKCQGLITIQMDHNNLTGVIPTSLGNLLSLDMLNLSYNDLSGVIPTVLSDLQLLSKLDLSYNRLRGAIPRNGVFEHPANVSLDGNSGLCG

HMMSmart: SM00369
IPR003591
412-434 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

TKLTRLHMNGNNLSGIVPLSLAN

HMMPfam: PF13855
438-495 LRR_8,Leucine rich repeat

IIDLDLSNNSLTGKIEGWLGSLINLQYLDLHGNNFAGSIPPSFGNLSELTILSLAQNE

HMMSmart: SM00369
IPR003591
459-482 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLQYLDLHGNNFAGSIPPSFGN

HMMSmart: SM00369
IPR003591
507-531 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSQLSRLDLSYNNLQGEIPPEISEL

HMMPfam: PF00560
IPR001611
509-531 LRR_1
Leucine-rich repeat

QLSRLDLSYNNLQGEIPPEISEL

Seg: seg
534-545 seg

LISLYLSSSRLS

HMMPfam: PF13855
558-616 LRR_8,Leucine rich repeat

LITIQMDHNNLTGVIPTSLGNLLSLDMLNLSYNDLSGVIPTVLSDLQLLSKLDLSYNRL

Seg: seg
575-593 seg

SLGNLLSLDMLNLSYNDLS

HMMSmart: SM00369
IPR003591
579-602 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLSLDMLNLSYNDLSGVIPTVLSD

Seg: seg
600-612 seg

LSDLQLLSKLDLS

HMMSmart: SM00369
IPR003591
603-628 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQLLSKLDLSYNRLRGAIPRNGVFEH

superfamily: SSF56112
IPR011009
690-1056 Protein kinase-like (PK-like)
Protein kinase-like domain

IPQATFSLLPSLGEKFPRVSYWDLARATSNFSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQLCKINMVNR

Gene3D: G3DSA:3.30.200.20
713-810 no description

LARATSNFSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTW

ProfileScan: PS50011
IPR000719
720-1053 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQLCKINM

HMMSmart: SM00219
IPR020635
720-1048 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQL

HMMSmart: SM00220
IPR002290
720-1050 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEINLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVATQLCK

HMMPfam: PF00069
IPR017442
723-1045 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

INLIGEGSYSSVYKGKLKQVKTEIAIKILDLEIPGAEGSFALECKALRGIRHRNIVPLITECSAIDNKGNAFRAIIYAFMPNGNLDTWLHHQGNQAAGRHLGLAQRISIATNIADALDYLHHYSGRPIIHCDLKPSNILLDIHMNACLGDFGIARFYIDSKLRTVGDSSSITVNGTLGYMAPGIVVXQMISFSKCFAYNYLPLPXLLIWSLFLEYAENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVA

PatternScan: PS00107
IPR017441
726-749 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYSSVYKGKLKQVKTEIAIK

PatternScan: PS00108
IPR008271
850-862 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDLKPSNILL

Gene3D: G3DSA:1.10.510.10
938-1046 no description

AENGHASTCGDVYSFGIVLLEMLTGKRPTDDMFRNELTIVRFVETNFPDHTLNFLDSRLVNECNGGIDQIAAGTENPPIFQSLLSLLRVALQCTRQSPTERLNMREVAT

Seg: seg
1058-1077 seg

GELGAQLLLGDLSAGLLKGA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox