PRGDB00070032 (Hv.26485)

From PRG Wiki
Jump to: navigation, search
Hv.26485
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151420184 (AK251536)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf128g18, mRNA sequence

DNA Sequence

GGAGCATCTTGGCTTACTGGATCTCAcccctccccgagctcctcgtttccctgctcctccccccctcaccctccgccattacccctcAATGCCCGCGCTGATTCGATTTCGCCGTCCAGATTTCAGACCACAAACACTTTTCATCTCATCCTTCTCTCCAGGTATTTGATGATCACAACATGTCATCAAACTCCACGCTCACAGAATCACTTCATGAGAAAACAATCGTCTTTGGGCTTAAACTTTGGGTTGTGATTGGGATCTCTGTTGGGGCATCCCTCCTGGGTATTCTTCTTATCCTTGTTATATGCCTTACCGTCCAAACCTGGATCAGACGCTCACGTAGGGCATTCAAGGAGCTTCCCATGACCCAGATACCTTCTGCATTCAAAGACATCACAGAAGTCAGGGTGCCTGACCAATTTTCACCGAATGATTATGTCGTACATGATGGGCTTCTACTCGCCATTGAGAATGGACCTGTTGAATCAACGGATAAAGATGCACTTCAATCGGCGCAGGAGGACAATTCGAGACATAGAGAAGAGAACAATCTTTCAGGTTCTTTTGTTCAAACTGATGGCTGTGATGGAATTCAGCCTGTTTCTGTCTGTGAACAGCCTTCTGTACATGCTACTGCCGATTCTGCGCCGTTGGACGGCCTACCTGAGTTTTCTTACCTTGGTTGGGGCCATTGGTTCACTCTCAGAGATCTAGATGTTGCAACCGACCATTTTTCAAAGGACAACGTAATTGGGGAGGGCGGATATGGTGTTGTGTATCGCGGCAGATTATCAAATGGCACCCCAGTCGCTGTCAAGAAAATCCTTAACAATTTAGGGCAGGCCGAGCGGGAATTCAGAGTGGAAGTTGAGGCAATTGGTAATGTTCGCCACAAGAATTTGGTCCGGCTTTTGGGATATTGTGTTGAGGGTACCCAGAGGATGCTTGTATACGAGTTTGTTAACAACGGGAATCTTGAAAGTTGGCTCCATGGAGAATTGTCCCAGTACAGCTCTCTCACTTGGTTAGCTCGCATGAAAGTTCTTCTGGGGACTGCAAAGGCCCTTGCATACTTGCATGAGGCACTTGAACCAAAGGTTGTGCATCGTGACATCAAGGCCAGCAATATCTTGATCGATGATGAGTTTAATGCCAAAATATCTGACTTCGGTTTGGCCAAGATGCTTGGTGCTGGTAAAAGTCATATTGCTACTCGAGTTATGGGTACCTTTGGCTATGTTGCGCCCGAGTATGCTAACAGTGGGCTTTTGAATGAGAAGAGTGATGTCTACAGCTTTGGGGTTCTTTTATTAGAAGTTATTACAGGTAGAGATCCAATTGACTATGATCGTCCCCCAAGTGAGGTAAACCTAGTCGACTGGCTTAAATTGATGGTCGCCAACAGACGGTCTGACGAAGTGGTGGATCCACACCTTGAGAGAAGACCGTCGACAAAGGAGCTGAAACGTGCCCTTTTGACAGCACTGCGGTGTATTGATCTGAATGCTGAGAAGAGACCAAGGATGGATCAGGTCGTCCGGATGTTGGATTCCAGTGAAACCATACCTCAAGAGGAACGAAGACCACGACAGAACCGGATCTCTGAGAATACTGAAACTGTGCCATTGAGGGGCAAGAACAGCACCGAGAAGAGTGATGCCCCTGAGCATGAGGAGAGGCCTCCTCGGCCAAAGAGTCGTCCATTTTCATCCAAATGAGGTAAAGAAGAGAAGGAAAGCCCAAACATCTTCTGCAGATGTAAAGATAGAGAGATACCTGCGCACGGAAGAACATCATGGAGAATTCTTCTGAATACGTAACAAATTGATCGATTTTTATTTTTCACTCCTCGGACGGGGATTTTTGCATTTGTTGATACATGGAATGTACAGTGGTGTGTATGACGGCTGAGGGGTGTACAGTACTACTAGCTTGTAAAACGGTCTGAAAAGCTCTCAGCTGGTGTGGTTGCTGGTATGAGCTACAGGCTTCTCTTATCTCTACTATCATATTGTACACACCATGAGTATAAAAGAAAAGAAAGAGAAGGaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.26485 translated coding region predicted by ESTScan from UniGene Hv.26485

XSILAYWISPLPELLVSLLLPPSPSAITPQCPRXFDFAVQISDHKHFSSHPSLQVFDDHNMSSNSTLTESLHEKTIVFGLKLWVVIGISVGASLLGILLILVICLTVQTWIRRSRRAFKELPMTQIPSAFKDITEVRVPDQFSPNDYVVHDGLLLAIENGPVESTDKDALQSAQEDNSRHREENNLSGSFVQTDGCDGIQPVSVCEQPSVHATADSAPLDGLPEFSYLGWGHWFTLRDLDVATDHFSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRMLDSSETIPQEERRPRQNRISENTETVPLRGKNSTEKSDAPEHEERPPRPKSRPFSSK

Domains

Domain Start-End Description Sequence

Seg: seg
9-25 seg

SPLPELLVSLLLPPSPS

HMMPanther: PTHR24420:SF937
80-561 SUBFAMILY NOT NAMED

LKLWVVIGISVGASLLGILLILVICLTVQTWIRRSRRAFKELPMTQIPSAFKDITEVRVPDQFSPNDYVVHDGLLLAIENGPVESTDKDALQSAQEDNSRHREENNLSGSFVQTDGCDGIQPVSVCEQPSVHATADSAPLDGLPEFSYLGWGHWFTLRDLDVATDHFSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRMLDSSETIPQEERRPRQNRISENTETVPLRGKNSTEKSDAPEHEER

HMMPanther: PTHR24420
80-561 FAMILY NOT NAMED,FAMILY NOT NAMED

LKLWVVIGISVGASLLGILLILVICLTVQTWIRRSRRAFKELPMTQIPSAFKDITEVRVPDQFSPNDYVVHDGLLLAIENGPVESTDKDALQSAQEDNSRHREENNLSGSFVQTDGCDGIQPVSVCEQPSVHATADSAPLDGLPEFSYLGWGHWFTLRDLDVATDHFSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRMLDSSETIPQEERRPRQNRISENTETVPLRGKNSTEKSDAPEHEER

Seg: seg
86-103 seg

IGISVGASLLGILLILVI

superfamily: SSF56112
IPR011009
216-517 Protein kinase-like (PK-like)
Protein kinase-like domain

SAPLDGLPEFSYLGWGHWFTLRDLDVATDHFSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRML

Gene3D: G3DSA:3.30.200.20
233-308 no description

WFTLRDLDVATDHFSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGY

ProfileScan: PS50011
IPR000719
246-523 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRMLDSSETI

HMMSmart: SM00219
IPR020635
246-517 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRML

HMMSmart: SM00220
IPR002290
246-517 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRML

HMMPfam: PF00069
IPR017442
248-515 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KDNVIGEGGYGVVYRGRLSNGTPVAVKKILNNLGQAEREFRVEVEAIGNVRHKNLVRLLGYCVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVR

PatternScan: PS00107
IPR017441
252-275 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYGVVYRGRLSNGTPVAVKK

Seg: seg
255-264 seg

GGYGVVYRGR

Gene3D: G3DSA:1.10.510.10
309-529 no description

CVEGTQRMLVYEFVNNGNLESWLHGELSQYSSLTWLARMKVLLGTAKALAYLHEALEPKVVHRDIKASNILIDDEFNAKISDFGLAKMLGAGKSHIATRVMGTFGYVAPEYANSGLLNEKSDVYSFGVLLLEVITGRDPIDYDRPPSEVNLVDWLKLMVANRRSDEVVDPHLERRPSTKELKRALLTALRCIDLNAEKRPRMDQVVRMLDSSETIPQEERR

PatternScan: PS00108
IPR008271
368-380 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKASNILI

Seg: seg
556-572 seg

PEHEERPPRPKSRPFSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox