PRGDB00070034 (Hv.26550)

From PRG Wiki
Jump to: navigation, search
Hv.26550
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151425995 (AK248418)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf172a03, mRNA sequence

DNA Sequence

GACACGAGCTCGTCTCCACACGCTCGATTTCGAAATTCTATCGTCTCTCCGCCGGCAACCACCAGCGTCTCCGTCCTCCGATGGAGCGGCCGGGGTGGAGCCTCTCCGACTTCCAAATCGGCAAGTTCATCGGCGAGGGCAAGTTTGGCAAGGTCTATCTCGCCCGCGAGAAGCAGAGCGGCTACGTGGTGGCGCTCAAGGTGATATACAAGACGAAGCTGCAGAAGTACCGGTTCCACGCGCACCTGCGGCGGGAGATCGAGATCCAGCACGGCCTCGACCACCCCAACGTGCTCCGCCTCTTCGCCTGGTTCCACGACGACCAGCGGGTCGTCCTCGTCCTCGAGTACGCCGCCCGTGGAGAGCTCTACAAGCTCCTCCGGAGCGTCGGCCACTTCTCGGAGCGGACCGCCGCCACCTATGTAGCAAGCCTTGCTGGTGCACTGGCATATTGTCACAAGAAGCAGGTAATTCACAGGGACATCAAGCCGGAAAATTTGCTCCTTGATATCGAGGGCCGACTTAAAATTGCAGATTTTGGATGGGCGGTTCGATCAAATGCTAAACGTCACACACTTTGTGGCACAATAGATTACCTGGCACCAGAGATGGTCGAGAAAAAGGCTCATGATTACGCTGTTGACAACTGGACTTTAGGAATCCTGTGCTACGAGTTTTTGTATGGATCACCACCCTTTGAAGCTGAAGAACAGCAAGATACCCTGATGAGGATAGTCAAAGTGGACTTGCTGTTTCCTAAAACTCGTGTCATATCTGCAGATGCCAAGGATCTCATTTGCAAGCTGCTAGTGAAGGATTCAAGCAAGAGGATTTCTCTGGACGATATTTTGAAGCATCCATGGATTGTTAAGAATGCAGAACCTTCAGGGAGTTGCATTGAGCAAAAATCTATTGCCTAAGCTCCTTAGGAAGTCCATGGTATTTGCTGCCGTTGCGAGCCGGACCGCATTTTGGGCGAAGTGCTTGTTTGCCAACATGCCAAACATGCAAGTAAACAGTTAGCATCATCTGTACTACTACCTCTGTAAACTAATTAGTGATATAAAATGTCTTATATTAATTTACAGAGGAAGTATATTATAACCCGGCCTTTCTCTAGAGAGGTTTCTTAAGTTAACCTACGAGGCTACTACTAATACCCACTTGGGGGTGAACCGGTGCTCAGAGATTACTGaaaaaaaaaaaccggtgttcagacaaaaaaaaaaaaaaaaT


Protein sequences

Name Description Sequence
Hv.26550 translated coding region predicted by ESTScan from UniGene Hv.26550

XHELVSTRSISKFYRLSAGNHQRLRPPMERPGWSLSDFQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWIVKNAEPSGSCIEQKSIA

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
24-296 Protein kinase-like (PK-like)
Protein kinase-like domain

LRPPMERPGWSLSDFQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWIVKNAEPS

Gene3D: G3DSA:3.30.200.20
26-146 no description

PPMERPGWSLSDFQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLA

HMMPanther: PTHR24350
33-306 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE IAL-RELATED

WSLSDFQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWIVKNAEPSGSCIEQKSIA

HMMPfam: PF00069
IPR017442
38-289 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWI

ProfileScan: PS50011
IPR000719
38-289 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWI

HMMSmart: SM00220
IPR002290
38-289 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWI

HMMSmart: SM00219
IPR020635
38-289 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FQIGKFIGEGKFGKVYLAREKQSGYVVALKVIYKTKLQKYRFHAHLRREIEIQHGLDHPNVLRLFAWFHDDQRVVLVLEYAARGELYKLLRSVGHFSERTAATYVASLAGALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWI

Seg: seg
40-51 seg

IGKFIGEGKFGK

PatternScan: PS00107
IPR017441
44-67 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGKFGKVYLAREKQSGYVVALK

Gene3D: G3DSA:1.10.510.10
147-294 no description

GALAYCHKKQVIHRDIKPENLLLDIEGRLKIADFGWAVRSNAKRHTLCGTIDYLAPEMVEKKAHDYAVDNWTLGILCYEFLYGSPPFEAEEQQDTLMRIVKVDLLFPKTRVISADAKDLICKLLVKDSSKRISLDDILKHPWIVKNAE

PatternScan: PS00108
IPR008271
157-169 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox