PRGDB00070035 (Hv.26562)

From PRG Wiki
Jump to: navigation, search
Hv.26562
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151420630 (AK251982)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf132f17, mRNA sequence

DNA Sequence

GGAGATGGAGGTTGCGGTGGTCGTCGGGCCGATAGTGAAGCTCTTGCCAAAGCTCCTATCGGTGATAGATGGGAAACGGAAGCAGCTGGACAGCCTGGAGGTAGACGCCGGATTCATCCGGCGCGACCTGCAGTCGATCCAAGAAATCATTGGCCGCTCGAATGGCAGCAGATCCATCACGGACCTCTGGGTCCGTGATCTCAGGCGCTTGGCGGACGACATGGAAGACTGCATCGACCGCTTCCAGGTCGGGAAGATGAGCAGAATCAGTTTCGTTGGGAAGATCTGCAAACTGAAGAAGAGGTCCAAGGAGACTCTCGAGCAGCTACAGAACTGCATCAGCATCGCGGGCGCCGCCGCACCGGCACCTGACCCCCCCTCTGCACCTGGTCACTGATCAGGATCCGGAAGAGCAACTTCTTGGCCTGCTTGCGCGGAGCCAACCGGAGGGGAATCTCAAGGTCATCTCCGTCGCCGGCTTCAGTGGAGTAGGTATGACTCGCCTTGCCCACAAGGTTTACAGTGACAGGGATGTGCGCAGCCAGTTCCCTCTGCACGCCTGGGTTCGTGCAGCACCGGGCATGAGTGTGCTCAAGCTTCTTCAGAAAATACATGACCAACTGATGTTAATCAGTATTACCAAGGATCATGGTGAGACTGCCTCCAACTCCAAAATCATACCACAAATCAACGGAAACGCCCAACATGCTGTGAGTGACCACCCGCTCGCCGGACTACTCAAGACTGGAAGGTATTTAATTGTGATTGATGGCGTGAATACACACGAGTTGTACGACGTACTATCTGCGTTCTCTTGGGCTGATGGAATGGACGGCAGAATTATCATGACGACGACCATTCAACTACCAGCAGCGACATGCTGCAAATGTGGCAACGGTTCATCACTTGCTATGGATAGCACAAGCCAAGTTTTCATTGGGGAGCTGACAGAGAGTGGATTTGTGGAATCCTGCCTCCATCTTCGTGATGACACTCTGGCAAGAATGCGCCGCAGCAGCAAAGAGATCCTATCCAGCCCCGTTGTCCAGGACTTATTGCTGTATTTCTGCATGTTCCCACGTGATCATCCTGTCAGGAGGAATCCCCTGATAAGGCGATGGCTGGCTGAAGGACTTGTGTTTCCTCAGCCTGAAACAGAGATTTTTTCCCAGGATGTTGCGGTCAAGAATTTGGAGAGCCTCATCAGCCGCAACATCATTCAGCCGATCCAAGTGAGGACCTATGGAAATGTGAAGAAATGCCAAACTTCTGGGATAATGCTCAACTCCATTTCCAGCAAATCCAAGTCACAGAATTTCATCACCATGTTGTGTGGCGGCCAGACAACAGAGAAGAATCTGCCAGGCAAAGAGATTCGCCGGCTTTCCCTCCATCTTAATGGTGCGGCAAATGGGCCACTGGATTTGCCAAAACAGTTATCTCGTCTCCATACTCTGGCAGTATTCCCTGATGATACAAATATCACCAGGCATCAAGCTAATTTGAATTATGCCGAGTATAAGCTACTGCGGGTTTTGGATCTCAAAGAATGTGCTGATGTGAAAGCAGAACATGTAGGGAAAATCTGTGACCTGTTGCTGCTCAAATATCTGAGCCTCGGAGACAGTATTGACAAGGTTCCAAGGAAAATAGTGAAGCTAAAATGGTTAGAGACTCTAGACATGAGGAGAACCCAGGTAGTAATGTTGCCAATTGAAGTCCTCCACCTTCCCGGGTTGAAACACCTCCTTGGAAAGCTTCAGCTACTTGAAGGTGACTGCACACAGAAGAAGCTAGAGAAGCTCTTGTCAGAAGATAGTGAACTGCAGAGGCTTTCCGGATTTGTCACCGACAAAAGCGAAGGGTTTGCCCAGCTGATGGGACGCATGGTGAAGTTGAGGAAGGTGAAAATATGGTGTGATTCAAGTGCAGATGTGACGAAACTGGATCATGTGTTAGGAGCCATGAAGAAATTCATTCGCGAAGGCCTGGATATGACACGAGTTGACCGTTCCTTGTCTATGGACTTCCAAGGATGCCCAACAGAATGCTCAGAACGATTCATGGATTCTCTGCAAGCTACAGGCCGTCTTACCTCGCTCAAGTTGAGAGGCAAGCTGACGCAGCTCCCTCAGTTCCAGGCAAAGCTGAACTACATTGAGGAGTTGAGCCTCTCAAGAACTAATCTGAGCGGGGACACAATCCTAGATGGCCTGTCTGAACTAAGGATGACACTGAAATATCTGAAGCTGGTAGAAGATAAGCTTGAGCACTTGGTCATAAAACCAGAACATTTCAGAAGCCTGAAGGGGTTATGCCTTGTGGGCGAGCAAAGGATGCAGGACATAACAATCCAAGATGAAGCTATGCCCTACCTTGTGTCACTTCACATACTTTGTGAAGCTCTAGGTAATCTTCCTGGCGTCGACATCACACACATGAAAAGGCTAAAAGAAGTCGCGCTCCATTCTGGAGTAGAAGAGATGATAAAGGATGGATGGCAAACAGCTGCAATGAACCATCCTAATAGGCCCAACGTTTTGTTTATCCACCATGCTAACTCCTCGCCTAGAGACTCTCCGCCGTGCCAAGCAACAGTGGAAATTGCAAATCGGACCAAACCTATTGGGAGAAAATTCACCGCCTCCATCATGGGGGGCATCTTTGCTTGTGCACGGCCAAGATCCTGATGCGCTGAATCAGCCGCATGGAACTCGTGCAAACCTGTTGCAAACATTCACTGATCGATGATGTGTGTGCTGCACGACCGTCGCGAGGTGTGGCCACCGGGCGGCCAAATGCGCGGGCTTCTCCTATGGGGCGTGGCGGCCGGTAGTGAGGACATTGAGATGACGCAGCTTCTTTATGATGATCAACGATGTCCGGATAAGCAAGTTACGAGCAAATTCTTCTGTTAACTTTTCAAAGGTCTGCACACAATGTCAAGAACAAAGTAAACAAATCCAGCCATACAGGTAATATTATGTAGATGTTTTGCTGAGTCGTCCTACCATCGAGAGTTCATCAATTTGATTCTGACAGAGAGATTGTACAATGGGATAGCCCTCTGCCTCTCTGTTCACATCAGGGATGTAAATGCATCGAATGAAGTATTCACACTTGTGTGTGGGCTTATTGTTGAGCTGGTGCCTCCCAGCAGACTTCGTGCaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.26562 translated coding region predicted by ESTScan from UniGene Hv.26562

XEMEVAVVVGPIVKLLPKLLSVIDGKRKQLDSLEVDAGFIRRDLQSIQEIIGRSNGSRSITDLWVRDLRRLADDMEDCIDRFQVGKMSRISFVGKICKLKKRSKETLEQLQNCISIAGAAAPAPDPPSAPGPDQDPEEQLLGLLARSQPEGNLKVISVAGFSGVGMTRLAHKVYSDRDVRSQFPLHAWVRAAPGMSVLKLLQKIHDQLMLISITKDHGETASNSKIIPQINGNAQHAVSDHPLAGLLKTGRYLIVIDGVNTHELYDVLSAFSWADGMDGRIIMTTTIQLPAATCCKCGNGSSLAMDSTSQVFIGELTESGFVESCLHLRDDTLARMRRSSKEILSSPVVQDLLLYFCMFPRDHPVRRNPLIRRWLAEGLVFPQPETEIFSQDVAVKNLESLISRNIIQPIQVRTYGNVKKCQTSGIMLNSISSKSKSQNFITMLCGGQTTEKNLPGKEIRRLSLHLNGAANGPLDLPKQLSRLHTLAVFPDDTNITRHQANLNYAEYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIVKLKWLETLDMRRTQVVMLPIEVLHLPGLKHLLGKLQLLEGDCTQKKLEKLLSEDSELQRLSGFVTDKSEGFAQLMGRMVKLRKVKIWCDSSADVTKLDHVLGAMKKFIREGLDMTRVDRSLSMDFQGCPTECSERFMDSLQATGRLTSLKLRGKLTQLPQFQAKLNYIEELSLSRTNLSGDTILDGLSELRMTLKYLKLVEDKLEHLVIKPEHFRSLKGLCLVGEQRMQDITIQDEAMPYLVSLHILCEALGNLPGVDITHMKRLKEVALHSGVEEMIKDGWQTAAMNHPNRPNVLFIHHANSSPRDSPPCQATVEIANRTKPIGRKFTASIMGGIFACARPRSXCAESAAWNSCKPVANIHXSMMCVLHDRREVWPPGGQMRGLLLWGVAAGSEDIEMTQLLYDDQRCPDKQVTSKFFC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF268
1-872 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

XEMEVAVVVGPIVKLLPKLLSVIDGKRKQLDSLEVDAGFIRRDLQSIQEIIGRSNGSRSITDLWVRDLRRLADDMEDCIDRFQVGKMSRISFVGKICKLKKRSKETLEQLQNCISIAGAAAPAPDPPSAPGPDQDPEEQLLGLLARSQPEGNLKVISVAGFSGVGMTRLAHKVYSDRDVRSQFPLHAWVRAAPGMSVLKLLQKIHDQLMLISITKDHGETASNSKIIPQINGNAQHAVSDHPLAGLLKTGRYLIVIDGVNTHELYDVLSAFSWADGMDGRIIMTTTIQLPAATCCKCGNGSSLAMDSTSQVFIGELTESGFVESCLHLRDDTLARMRRSSKEILSSPVVQDLLLYFCMFPRDHPVRRNPLIRRWLAEGLVFPQPETEIFSQDVAVKNLESLISRNIIQPIQVRTYGNVKKCQTSGIMLNSISSKSKSQNFITMLCGGQTTEKNLPGKEIRRLSLHLNGAANGPLDLPKQLSRLHTLAVFPDDTNITRHQANLNYAEYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIVKLKWLETLDMRRTQVVMLPIEVLHLPGLKHLLGKLQLLEGDCTQKKLEKLLSEDSELQRLSGFVTDKSEGFAQLMGRMVKLRKVKIWCDSSADVTKLDHVLGAMKKFIREGLDMTRVDRSLSMDFQGCPTECSERFMDSLQATGRLTSLKLRGKLTQLPQFQAKLNYIEELSLSRTNLSGDTILDGLSELRMTLKYLKLVEDKLEHLVIKPEHFRSLKGLCLVGEQRMQDITIQDEAMPYLVSLHILCEALGNLPGVDITHMKRLKEVALHSGVEEMIKDGWQTAAMNHPNRPNVLFIHHANSSPRDSPPCQATVEIANR

HMMPanther: PTHR23155
1-872 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

XEMEVAVVVGPIVKLLPKLLSVIDGKRKQLDSLEVDAGFIRRDLQSIQEIIGRSNGSRSITDLWVRDLRRLADDMEDCIDRFQVGKMSRISFVGKICKLKKRSKETLEQLQNCISIAGAAAPAPDPPSAPGPDQDPEEQLLGLLARSQPEGNLKVISVAGFSGVGMTRLAHKVYSDRDVRSQFPLHAWVRAAPGMSVLKLLQKIHDQLMLISITKDHGETASNSKIIPQINGNAQHAVSDHPLAGLLKTGRYLIVIDGVNTHELYDVLSAFSWADGMDGRIIMTTTIQLPAATCCKCGNGSSLAMDSTSQVFIGELTESGFVESCLHLRDDTLARMRRSSKEILSSPVVQDLLLYFCMFPRDHPVRRNPLIRRWLAEGLVFPQPETEIFSQDVAVKNLESLISRNIIQPIQVRTYGNVKKCQTSGIMLNSISSKSKSQNFITMLCGGQTTEKNLPGKEIRRLSLHLNGAANGPLDLPKQLSRLHTLAVFPDDTNITRHQANLNYAEYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIVKLKWLETLDMRRTQVVMLPIEVLHLPGLKHLLGKLQLLEGDCTQKKLEKLLSEDSELQRLSGFVTDKSEGFAQLMGRMVKLRKVKIWCDSSADVTKLDHVLGAMKKFIREGLDMTRVDRSLSMDFQGCPTECSERFMDSLQATGRLTSLKLRGKLTQLPQFQAKLNYIEELSLSRTNLSGDTILDGLSELRMTLKYLKLVEDKLEHLVIKPEHFRSLKGLCLVGEQRMQDITIQDEAMPYLVSLHILCEALGNLPGVDITHMKRLKEVALHSGVEEMIKDGWQTAAMNHPNRPNVLFIHHANSSPRDSPPCQATVEIANR

Seg: seg
114-133 seg

ISIAGAAAPAPDPPSAPGPD

HMMPfam: PF00931
IPR002182
138-285 NB-ARC,NBS
NB-ARC

EQLLGLLARSQPEGNLKVISVAGFSGVGMTRLAHKVYSDRDVRSQFPLHAWVRAAPGMSVLKLLQKIHDQLMLISITKDHGETASNSKIIPQINGNAQHAVSDHPLAGLLKTGRYLIVIDGVNTHELYDVLSAFSWADGMDGRIIMTT

superfamily: SSF52540
151-288 P-loop containing nucleoside triphosphate hydrolases

GNLKVISVAGFSGVGMTRLAHKVYSDRDVRSQFPLHAWVRAAPGMSVLKLLQKIHDQLMLISITKDHGETASNSKIIPQINGNAQHAVSDHPLAGLLKTGRYLIVIDGVNTHELYDVLSAFSWADGMDGRIIMTTTIQ

FPrintScan: PR00364
IPR000767
155-170 DISEASERSIST
Disease resistance protein

VISVAGFSGVGMTRLA

FPrintScan: PR00364
IPR000767
246-260 DISEASERSIST
Disease resistance protein

LLKTGRYLIVIDGVN

superfamily: SSF52058
422-824 L domain-like,LRR

QTSGIMLNSISSKSKSQNFITMLCGGQTTEKNLPGKEIRRLSLHLNGAANGPLDLPKQLSRLHTLAVFPDDTNITRHQANLNYAEYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIVKLKWLETLDMRRTQVVMLPIEVLHLPGLKHLLGKLQLLEGDCTQKKLEKLLSEDSELQRLSGFVTDKSEGFAQLMGRMVKLRKVKIWCDSSADVTKLDHVLGAMKKFIREGLDMTRVDRSLSMDFQGCPTECSERFMDSLQATGRLTSLKLRGKLTQLPQFQAKLNYIEELSLSRTNLSGDTILDGLSELRMTLKYLKLVEDKLEHLVIKPEHFRSLKGLCLVGEQRMQDITIQDEAMPYLVSLHILCEALGNLPGVDITHMKRLKEVALHS

FPrintScan: PR00364
IPR000767
505-521 DISEASERSIST
Disease resistance protein

AEYKLLRVLDLKECADV

Seg: seg
532-540 seg

LLLLKYLSL

Seg: seg
575-590 seg

LHLPGLKHLLGKLQLL

Seg: seg
597-609 seg

KKLEKLLSEDSEL

Gene3D: G3DSA:3.80.10.10
680-822 no description

CPTECSERFMDSLQATGRLTSLKLRGKLTQLPQFQAKLNYIEELSLSRTNLSGDTILDGLSELRMTLKYLKLVEDKLEHLVIKPEHFRSLKGLCLVGEQRMQDITIQDEAMPYLVSLHILCEALGNLPGVDITHMKRLKEVAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox