PRGDB00070036 (Hv.26576)

From PRG Wiki
Jump to: navigation, search
Hv.26576
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 151426621 (AK253014)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare cDNA clone: FLbaf12d15, mRNA sequence

DNA Sequence

GGTGTTGTTCAATGGCGGCTCACCGTGTCGCCCTGTGTGTGCTCATCCTTGCCGTCGCACTGCTCGCGCCCAGCCGCCACGTCGCCGGAGAACCGTGGCAAGTGTGCGGCGACAGCGGCGAATACGACGACAAGAGCGAGTACCAGGCCAACCTCAACCTCGTCGCCCACGCGCTCCCCAAGAAGGCCTCGGCGTCGCGCAACCTCTTCGCCACCGCCGAGGCCGGCGCTGTCCCGGAGAAGGTCACGGCCCTCGCGCTCTGCCGCGGCGACGCCACCTCCAGGGCCTGCTCCACCTGCCTCGCCAACGCCTTCGACAACCTCCCCAACGTGTGCCAGGGCTCCAAGGACGCCGTCATCTACTACGACGCCTGCATGCTCCGCTACTCCGACGTGCAGTTCCTCTCCGCCGACGACTCCGGTCCCATGGGCTTGGACCTCAGCATGACGGTCCGCAACTCCGTGAACGCCACGTCGGAGCCTGGCCGGTTCGAGCGCGTCGTGGCCGCGCTCATGAACGCCACCGCCGACTACGCCGCGTACAACTCCACCCGGCGGTACGCCACCGGCCAGGCCGACCTCGACCGGGAGTTCCCCAAGGTGTACAGCTGGGCGCAGTGCACCCCGGACCTGACGCCGGGAAGGTGCCGGGACTGCCTCGCCCAGATCTTGGCGCAGCTGCCGCTGCAGTTCACGGACGGTATCGGAGGCAGGCTTCTTGCTCCCCGATGCAGCTTCCGGTACGAGACCAAGCCCTTCATGACCGGCCCAGTGATCGTGCAGCTGCCAGCAACGTCGGCCACCTCTGGAGCACCGGCGCCGGCCGTAGCCCCCACCGCTCCTGCGCCGGCGACACCACAGGGGAGAAAGTACAGTGTTCCTGGCATGGTTCTTATAATTCTCTTGCCTACAATAGCAGCCATAAACCTCATTGTTTGGCTCTTTTCATGGAGGAGGAGGCAGGCACTTGCAAAGGCAAAGCAACCGGGTCCAGATTATTCCAGTGATGAAGCACATGACATGGAAAGTGTGGAGTCAATGTTAATCGACATTTCAACTTTGCGGGCTGCAACCGAGGATTTTGCAGAAAGCAACAAACTCGGCGAAGGTGGATTTGGCCCCGTGTACAAGGGTACTCTCCTAAGCGGCGACGAGATCGCAGTGAAGAGAATGTCCAAGACCTCAACACAAGGAGTGGAGGAGCTCAAGAATGAGCTCGCCTTAGTTGCAAAGCTGAAGCACAAGAACCTTGTCAGACTTGTGGGTGTCTGCTTGGAGCAACAAGAGAGGCTGCTCATCTATGAGTTTGTTCCTAACCGCAGCCTCGACCTGATCCTTTTCGATGAAGAGAAACGTCGGCAATTGGATTGGGAAACGAGGTTCAAGATCATAAATGGAGTCGCTCGTGGCATACAGTACCTCCATGAAGACTCTCAACTCAAAGTAGTCCATCGTGACCTCAAAGCGAGCAACGTCTTGTTAGACATGAACATGAACCCGAAGATCTCGGATTTCGGCCTGGCCAAGATTTTCGGGAGAGACCAGACCCAGGGCGTGACGAACCGCGTCATCGGCACATATGGATACATGGCGCCAGAGTACGTGATGCGTGGGAATTACTCTGTGAAATCAGACGCGTTCAGCTTTGGCGTTTTGGTTCTAGAGGTCGTGACTGGAAAGAAGAACAGTGACTGCTGCAACACTCAGCAATCACAGGATCTCTTGACCACAGTATGGGAGCATTGGACTGCCGGAACAGTGTTGGAGATGGTAGACCCATGCATGGACAAGAACTTCTCGGAGAGCGATGCGGTGAGGTGCATCCATGTCGGGCTTTTGTGCATCCAGAGCAGCCCGGAAGACCGGCCGATGATGTCGATGGTGGCCATGATGCTCGGCAGCGACACATTCCCTCTGCCCGCTCCGTCGAAGCCGGCCTTATACTCTACAAACGTTGGTGCCAATTCAAGCACCGGGTCAAGCATGTCGATCCCATCAGTGCAGGCCCGGTCATAGCTAGTAGATTTTTCTTCATCGCAACAACTTACAGCCGAAATGGCCAATGCGTCTCTGGTGTCATTGCATCCGAATTGGAAGAATAATTTAAAATTTTCAGCAAGAGTCAAAAAATTCCAGAATTTGTTTGGAGTCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Hv.26576 translated coding region predicted by ESTScan from UniGene Hv.26576

XCCSMAAHRVALCVLILAVALLAPSRHVAGEPWQVCGDSGEYDDKSEYQANLNLVAHALPKKASASRNLFATAEAGAVPEKVTALALCRGDATSRACSTCLANAFDNLPNVCQGSKDAVIYYDACMLRYSDVQFLSADDSGPMGLDLSMTVRNSVNATSEPGRFERVVAALMNATADYAAYNSTRRYATGQADLDREFPKVYSWAQCTPDLTPGRCRDCLAQILAQLPLQFTDGIGGRLLAPRCSFRYETKPFMTGPVIVQLPATSATSGAPAPAVAPTAPAPATPQGRKYSVPGMVLIILLPTIAAINLIVWLFSWRRRQALAKAKQPGPDYSSDEAHDMESVESMLIDISTLRAATEDFAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMMLGSDTFPLPAPSKPALYSTNVGANSSTGSSMSIPSVQAPVIASRFFFIATTYSRNGQCVSGVIASELEE

Domains

Domain Start-End Description Sequence

Seg: seg
10-23 seg

VALCVLILAVALLA

ProfileScan: PS51473
IPR002902
30-134 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

GEPWQVCGDSGEYDDKSEYQANLNLVAHALPKKASASRNLFATAEAGAVPEKVTALALCRGDATSRACSTCLANAFDNLPNVCQGSKDAVIYYDACMLRYSDVQF

HMMPfam: PF01657
IPR002902
33-132 Stress-antifung
Gnk2-homologous domain

WQVCGDSGEYDDKSEYQANLNLVAHALPKKASASRNLFATAEAGAVPEKVTALALCRGDATSRACSTCLANAFDNLPNVCQGSKDAVIYYDACMLRYSDV

HMMPanther: PTHR24420:SF430
101-699 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LANAFDNLPNVCQGSKDAVIYYDACMLRYSDVQFLSADDSGPMGLDLSMTVRNSVNATSEPGRFERVVAALMNATADYAAYNSTRRYATGQADLDREFPKVYSWAQCTPDLTPGRCRDCLAQILAQLPLQFTDGIGGRLLAPRCSFRYETKPFMTGPVIVQLPATSATSGAPAPAVAPTAPAPATPQGRKYSVPGMVLIILLPTIAAINLIVWLFSWRRRQALAKAKQPGPDYSSDEAHDMESVESMLIDISTLRAATEDFAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMMLGSDTFPLPAPSKPALYSTNVGANSSTGSSMSIPSVQAPVIASRFFFIATTYSRNGQCVSGVIASELE

HMMPanther: PTHR24420
101-699 FAMILY NOT NAMED,FAMILY NOT NAMED

LANAFDNLPNVCQGSKDAVIYYDACMLRYSDVQFLSADDSGPMGLDLSMTVRNSVNATSEPGRFERVVAALMNATADYAAYNSTRRYATGQADLDREFPKVYSWAQCTPDLTPGRCRDCLAQILAQLPLQFTDGIGGRLLAPRCSFRYETKPFMTGPVIVQLPATSATSGAPAPAVAPTAPAPATPQGRKYSVPGMVLIILLPTIAAINLIVWLFSWRRRQALAKAKQPGPDYSSDEAHDMESVESMLIDISTLRAATEDFAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMMLGSDTFPLPAPSKPALYSTNVGANSSTGSSMSIPSVQAPVIASRFFFIATTYSRNGQCVSGVIASELE

ProfileScan: PS51473
IPR002902
145-253 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

LDLSMTVRNSVNATSEPGRFERVVAALMNATADYAAYNSTRRYATGQADLDREFPKVYSWAQCTPDLTPGRCRDCLAQILAQLPLQFTDGIGGRLLAPRCSFRYETKPF

HMMPfam: PF01657
IPR002902
156-253 Stress-antifung
Gnk2-homologous domain

NATSEPGRFERVVAALMNATADYAAYNSTRRYATGQADLDREFPKVYSWAQCTPDLTPGRCRDCLAQILAQLPLQFTDGIGGRLLAPRCSFRYETKPF

Seg: seg
263-286 seg

PATSATSGAPAPAVAPTAPAPATP

superfamily: SSF56112
IPR011009
333-655 Protein kinase-like (PK-like)
Protein kinase-like domain

YSSDEAHDMESVESMLIDISTLRAATEDFAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMMLGSDTFPLPAPSKPALYSTNVGAN

Gene3D: G3DSA:3.30.200.20
349-423 no description

IDISTLRAATEDFAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGV

ProfileScan: PS50011
IPR000719
361-637 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMMLGSDTF

HMMSmart: SM00219
IPR020635
361-632 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMML

HMMSmart: SM00220
IPR002290
361-632 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAESNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMSMVAMML

HMMPfam: PF00069
IPR017442
364-569 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNKLGEGGFGPVYKGTLLSGDEIAVKRMSKTSTQGVEELKNELALVAKLKHKNLVRLVGVCLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQ

Gene3D: G3DSA:1.10.510.10
424-626 no description

CLEQQERLLIYEFVPNRSLDLILFDEEKRRQLDWETRFKIINGVARGIQYLHEDSQLKVVHRDLKASNVLLDMNMNPKISDFGLAKIFGRDQTQGVTNRVIGTYGYMAPEYVMRGNYSVKSDAFSFGVLVLEVVTGKKNSDCCNTQQSQDLLTTVWEHWTAGTVLEMVDPCMDKNFSESDAVRCIHVGLLCIQSSPEDRPMMS

PatternScan: PS00108
IPR008271
482-494 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox