PRGDB00070147 (Hv.31755)

From PRG Wiki
Jump to: navigation, search
Hv.31755
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 310914325 (FR717136)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare mRNA for putative cysteine rich repeat-receptor-like protein kinase DUF26 (crk1 gene), cultivar Pallas

DNA Sequence

GAGAACCTCACTCTGGCAAAAGAGAAACAAGAACCTGTTGTAGTTAGCTACTCTTGTACTCGTGTTAGCTTGCCATGGCGACCATCGGCGTCGTCCTCCTCCTGCTCCTCCTACCCACACCCACACCCTTTCTGGTGGCCGCCAATTTCTGCGACAACGTCAAGGTAGCCGCTGCCGCCCTTTCCAAGAACGTCACCTCCTCCCCGGAAAACTTCGCCACCGCCACCTTTGGCCAGCCCCCCGACGTCGTCTACGCGCTCGCGCTCTGCCGCGCCGGTGACGTCGTCGACGGCTCCACCTGTAGTGACTGCATCGCTAACTGGTTCGCTGCAGTAAACCAGACGGAGTGCCACAAGGTCCGCTCCAGCTACGGCGACTGTATTGTCGTCTACAGCGCCGGCGACGACAACCTACCGCCACCCTCAAATGTCATGGGAGGATCCTCCGGTGAGAACACGCTGCCCTTCGAGCAGTGGGACATCACGAACGTCACCACCGGCGACGTCCAACTCATCGTCGGCCTCACCCGCGAGTTGCTGGTCGAGACAGCCGAGACGGCGGCCAGCACGACGCCGAGTCGGTACGCCACTGGCGTCATAGACATGGACAGAGTGACGACCTACCCGAAGGTGTACTCCCAGGCGCATTGCATGCCGGACCTGTCCGCCGATAACTGCTTGGCATGCCTGCGGCGTCTCCTCGGGATGGTCAACTCCACCATGTCCCTCCGCACGGGTGGACAAATGGGCATCACGCAATGCTATTTCAGGTACGAAGCTTATCGGTTCTATGGCGCCCAACCCATGCTGATTGTGCCATTGCCGACACCGGCGCTGGCAACCAAACACAGGAGCATGTTGTGGGTAATTCTCGCAGTTGTAGTTCCTCTTTCGGCAGCAGCATTTGTCTTCTTCGTCTGTTACTCTCGTCGGCTCAGGAGCCAAAGAAAAGGATCAAGACGTGATTGGAATTTAAAGGGAGATCTAGTTTGGCAAGGGAAAAATTCGGAGTTCTCTTTGTTTGACTTTCACCAGCTAGTGGAGGCCACAGACAGTTTTTCAGAAGAAAACAAACTTGGACAGGGTGGCTTTGGCGCTGTCTACAAGGGCGAACTTCCCGAGGGATTGGAGGTAGCAGTCAAGAGACTGTCTTCGCATTCTGGACAAGGTTTCATGGAGTTCAAAAATGAAGTCCAACTAATAGCCAAACTCCAGCACACAAATTTGGTTAGGCTCTTGGGATGTTGCTCTCAAGATGAGGAGAACATACTGGTTTATGAATACTTGCCAAACAGAAGTCTGGATTTCTTCATCTCTGACGTGAATAAAAGAGCTTTAATGGATTGGTCAACACATGTAGCAATAATTGAAGGAGTAGCACATGGACTTCTTTACCTACATAAGCACTCTCGTCTGCTTGTCATACACCGAGACCTTAAACCAAGCAATATTCTCTTGGACTACGAACTGAATCCAAAAATTTCAGATTTTGGGCTAGCAAAAATATTGAGCTCAAATGACACTGAAGGAAATACCACAAGACGAGTAGTTGGCACATCTGGCTACATGGCACCAGAGTATGCTTCAAAGGGCGTATTCTCAATTAAATCCGATGTCTTCAGTTTTGGTGTTGTCATTTTTGAGATCCTTAGCGGAAAACAGAATTCTGGTAACGAACAATATGGAGGTTTCCTCAATCTGCTTGGACATGCATGGCAATTATGGGAAGAAGGAAAGTGGGCTGATCTCATTGCTGCACCATTGCTACCCGGAAGTCACTCAGCAAAGATGATGAGATACTTTAATATAGCATTATTGTGTGTACAAGAGAATGCAACTGATAGACCAACCATGGGCGATATTGTTGCAATGCTAAGCAATGATGCTATGATATTGGCTGAGCCTAAGCAGCCAGCATATATTAATGTAAGGGTGGGAAATGAAGAAGCGTCCACAGCTCTTGAGGCGTGCAATATTAAAGATATGACCATATCTGCGACAATTCATGGATAGTCTTATCCCTGGTGCCATGTTTTAAAATTTCCAGTCGTAATATTCACAACAAAATGTTGTATAATGCGTACCGTCAAATGGTGTTCAAATGTGAGGTTATGTGCCCTAAAGAGTATCAAAAGAAAGCTTCCGCGGTAGCTGGAGTAAACAATCA


Protein sequences

Name Description Sequence
Hv.31755 translated coding region predicted by ESTScan from UniGene Hv.31755

MATIGVVLLLLLLPTPTPFLVAANFCDNVKVAAAALSKNVTSSPENFATATFGQPPDVVYALALCRAGDVVDGSTCSDCIANWFAAVNQTECHKVRSSYGDCIVVYSAGDDNLPPPSNVMGGSSGENTLPFEQWDITNVTTGDVQLIVGLTRELLVETAETAASTTPSRYATGVIDMDRVTTYPKVYSQAHCMPDLSADNCLACLRRLLGMVNSTMSLRTGGQMGITQCYFRYEAYRFYGAQPMLIVPLPTPALATKHRSMLWVILAVVVPLSAAAFVFFVCYSRRLRSQRKGSRRDWNLKGDLVWQGKNSEFSLFDFHQLVEATDSFSEENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLGCCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDIVAMLSNDAMILAEPKQPAYINVRVGNEEASTALEACNIKDMTISATIHG

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
7-111 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

VLLLLLLPTPTPFLVAANFCDNVKVAAAALSKNVTSSPENFATATFGQPPDVVYALALCRAGDVVDGSTCSDCIANWFAAVNQTECHKVRSSYGDCIVVYSAGDD

HMMPfam: PF01657
IPR002902
24-107 Stress-antifung
Gnk2-homologous domain

NFCDNVKVAAAALSKNVTSSPENFATATFGQPPDVVYALALCRAGDVVDGSTCSDCIANWFAAVNQTECHKVRSSYGDCIVVYS

ProfileScan: PS51473
IPR002902
127-238 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

NTLPFEQWDITNVTTGDVQLIVGLTRELLVETAETAASTTPSRYATGVIDMDRVTTYPKVYSQAHCMPDLSADNCLACLRRLLGMVNSTMSLRTGGQMGITQCYFRYEAYRF

HMMPfam: PF01657
IPR002902
152-238 Stress-antifung
Gnk2-homologous domain

RELLVETAETAASTTPSRYATGVIDMDRVTTYPKVYSQAHCMPDLSADNCLACLRRLLGMVNSTMSLRTGGQMGITQCYFRYEAYRF

HMMPanther: PTHR24420
173-637 PTHR24420,FAMILY NOT NAMED

GVIDMDRVTTYPKVYSQAHCMPDLSADNCLACLRRLLGMVNSTMSLRTGGQMGITQCYFRYEAYRFYGAQPMLIVPLPTPALATKHRSMLWVILAVVVPLSAAAFVFFVCYSRRLRSQRKGSRRDWNLKGDLVWQGKNSEFSLFDFHQLVEATDSFSEENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLGCCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDIVAMLSNDAMILAEPKQPAYINVRVGNEEASTALEACNIKDM

HMMPanther: PTHR24420:SF430
173-637 PTHR24420:SF430,SUBFAMILY NOT NAMED

GVIDMDRVTTYPKVYSQAHCMPDLSADNCLACLRRLLGMVNSTMSLRTGGQMGITQCYFRYEAYRFYGAQPMLIVPLPTPALATKHRSMLWVILAVVVPLSAAAFVFFVCYSRRLRSQRKGSRRDWNLKGDLVWQGKNSEFSLFDFHQLVEATDSFSEENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLGCCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDIVAMLSNDAMILAEPKQPAYINVRVGNEEASTALEACNIKDM

superfamily: SSF56112
IPR011009
298-600 Kinase_like
Protein kinase-like domain

WNLKGDLVWQGKNSEFSLFDFHQLVEATDSFSEENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLGCCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDIVAML

Gene3D: G3DSA:3.30.200.20
310-389 G3DSA:3.30.200.20

NSEFSLFDFHQLVEATDSFSEENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLG

ProfileScan: PS50011
IPR000719
328-606 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLGCCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDIVAMLSNDAMI

HMMPfam: PF07714
IPR001245
331-600 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKLGQGGFGAVYKGELPEGLEVAVKRLSSHSGQGFMEFKNEVQLIAKLQHTNLVRLLGCCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDIVAML

PatternScan: PS00107
IPR017441
334-356 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGAVYKGELPEGLEVAVK

Gene3D: G3DSA:1.10.510.10
390-596 G3DSA:1.10.510.10

CCSQDEENILVYEYLPNRSLDFFISDVNKRALMDWSTHVAIIEGVAHGLLYLHKHSRLLVIHRDLKPSNILLDYELNPKISDFGLAKILSSNDTEGNTTRRVVGTSGYMAPEYASKGVFSIKSDVFSFGVVIFEILSGKQNSGNEQYGGFLNLLGHAWQLWEEGKWADLIAAPLLPGSHSAKMMRYFNIALLCVQENATDRPTMGDI

PatternScan: PS00108
IPR008271
449-461 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox