PRGDB00070328 (Lja.15692)

From PRG Wiki
Jump to: navigation, search
Lja.15692
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 293546175 (FS360088)
Gene Class Unknown
Domain Type
Gene Species Lotus japonicus

Comment?

FS360088 LjFL3 Lotus japonicus cDNA clone LjFL3-047-CG01.r0 3', mRNA sequence

DNA Sequence

tttttttttttttttttGCATCAAAAGTAGGGAATAAGTAGTACATCCTCCAAAAAGTGCAAAAGAGGGATAACATTAATATGTTTATTTAACAGAAAACCATGAAAGAAAAGTAATTACAAGAATTGGTTGTGATGTGACTCAAATCCTGGAAGGGATCATAGGAATATTATTCTGAAAGTATGCACTAGCAGCAGCAACTCCACTTCCAAGCTTTACAGGGTATCCCACATCGTTCAGTATCATCTCCACACCAGCAAGACAACCCAAGAGTTGCAACTCATTCAAGTTGCCAAGATGTCCTATTCTGAAAACCTTCCCAGCAACTTTGTTTAATCCCAGTCCTAAGCTCATGTTGTATCTCTTCCATGACCTTCTAACTACTTCAGCAGCATCAATGTAAGGAGGAACAAGAACTGCAGTCACAGTGTCACTGTACCACTCTTCTTTTTGGGTGCAGTTCTTCAAACCCCATGCTTCAACTGCAAGCCTGGTTGCATGGCCTAAACGTTTGTGCCTTAAAATCACATTATCAAGTCCTTCCTCAAAAATCAGGTCAAGAGCTTCTCTGAGACCATAGAGCAACTGAATGGAAGGAGTGTAAGGCCAATATGTTCCCAACTTGTAGAACTTCAAGTAGTCATTCCAGTCAAAGAAAACTCTGAGTGATTTGGCAGATTTTGAAGCCTCAATGGCTTTAGGACCTGCACAGACAATGCCTAACCCAGTGGGAAGGGAAAGAGCTTTCTGGGAGCCAGTCACGGCCACATCCACTCCCCATTCATCCATGCGGAAATCG


Protein sequences

Name Description Sequence
Lja.15692 translated coding region predicted by ESTScan from UniGene Lja.15692

XDFRMDEWGVDVAVTGSQKALSLPTGLGIVCAGPKAIEASKSAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLREALDLIFEEGLDNVILRHKRLGHATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDAAEVVRRSWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILNDVGYPVKLGSGVAAASAYFQNNIPMIPSRI

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.640.10
IPR015421
2-75 no description
Pyridoxal phosphate-dependent transferase, major r

DFRMDEWGVDVAVTGSQKALSLPTGLGIVCAGPKAIEASKSAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLY

HMMPanther: PTHR21152:SF7
2-219 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DFRMDEWGVDVAVTGSQKALSLPTGLGIVCAGPKAIEASKSAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLREALDLIFEEGLDNVILRHKRLGHATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDAAEVVRRSWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILNDVGYPVKLGSGVAAASAYFQNNIPMIPSRI

HMMPanther: PTHR21152
2-219 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

DFRMDEWGVDVAVTGSQKALSLPTGLGIVCAGPKAIEASKSAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLREALDLIFEEGLDNVILRHKRLGHATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDAAEVVRRSWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILNDVGYPVKLGSGVAAASAYFQNNIPMIPSRI

superfamily: SSF53383
IPR015424
2-195 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

DFRMDEWGVDVAVTGSQKALSLPTGLGIVCAGPKAIEASKSAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLREALDLIFEEGLDNVILRHKRLGHATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDAAEVVRRSWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILNDVGYPV

HMMPfam: PF00266
IPR000192
4-142 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

RMDEWGVDVAVTGSQKALSLPTGLGIVCAGPKAIEASKSAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLREALDLIFEEGLDNVILRHKRLGHATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDAAEVVR

PatternScan: PS00595
IPR020578
10-30 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVAVTGSQKALSLPTGLGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
76-201 no description
Pyridoxal phosphate-dependent transferase, major r

GLREALDLIFEEGLDNVILRHKRLGHATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDAAEVVRRSWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILNDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox