PRGDB00070390 (Lja.18473)

From PRG Wiki
Jump to: navigation, search
Lja.18473
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223417786 (GO005753)
Gene Class Unknown
Domain Type
Gene Species Lotus japonicus

Comment?

LJGB380TF JCVI-LJ1 Lotus japonicus cDNA 5', mRNA sequence

DNA Sequence

GGAAACGCAATCGAGCCAAACCCGAACGTTAACTGAGACCAGAAGAAAAGCAAAAACATCCACTCCCTCCTCTTCACCAGTCCCCAACGTCGCCACCCGATTCATCGCGTTTCGCAAAATGGCGACGTTTGAACTGTACCGAAGGTCGACGATCGGAATGTGCCTCACGGAGACTTTGGATGAGATGGTTCAGAATGGTACTCTCAGCCCTGAGCTTGTGATTCAGGTTCTGGTTCAGTTCGATAAGTCTATGACTGAGGCTCTGGAAACTCAGGTTAAGAGCAAGGTCTCGATCAAGGGACATCTCCATACATATAGGTTTTGTGACAATGTTTGGACTTTCATCTTACAAGATGCTTTGTTCAAGAATGAGGACAACCAGGAGAATGTTGGACGGGTTAAAATAGTGGCGTGTGACTCGAAGTTGCTCACACAATGAATTGCCAATTTCTGCCACATTGTCAACAAGGAGAAATTGTTGTCAATCATCTGCTGGTAACTATTGGAATGTTGGGTCAGATTAATGTTACAGGAACTAGCATCTTTATAGTATGTTACATATTTAAATGTGATCGATCTTCATGTCATTAGGTAATTAATGTTACATTAAAATTTGACAATATCTCTTCAGAGATAGATGTACTCTTTTTAAACTGTACTAAATTATATTCTTCCATGAAC


Protein sequences

Name Description Sequence
Lja.18473 translated coding region predicted by ESTScan from UniGene Lja.18473

XETQSSQTRTLTETRRKAKTSTPSSSPVPNVATRFIAFRKMATFELYRRSTIGMCLTETLDEMVQNGTLSPELVIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSKLLTQ

Domains

Domain Start-End Description Sequence

Seg: seg
14-33 seg

TRRKAKTSTPSSSPVPNVAT

Gene3D: G3DSA:1.10.287.190
IPR015872
40-94 no description
Transcription initiation factor IIA, gamma subunit

KMATFELYRRSTIGMCLTETLDEMVQNGTLSPELVIQVLVQFDKSMTEALETQVK

HMMPanther: PTHR10966
IPR003194
41-143 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQNGTLSPELVIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSKL

BlastProDom: PD009224
IPR015872
41-90 T2AG_ARATH_Q39236;
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQNGTLSPELVIQVLVQFDKSMTEALE

HMMPfam: PF02268
IPR015872
43-90 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

TFELYRRSTIGMCLTETLDEMVQNGTLSPELVIQVLVQFDKSMTEALE

superfamily: SSF47396
IPR009083
44-94 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSTIGMCLTETLDEMVQNGTLSPELVIQVLVQFDKSMTEALETQVK

HMMPfam: PF02751
IPR015871
92-141 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDS

superfamily: SSF50784
IPR009088
92-142 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSK

Gene3D: G3DSA:2.30.18.10
IPR009088
95-145 no description
Transcription factor IIA, beta-barrel

SKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSKLLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox