PRGDB00070585 (Lsa.2455)

From PRG Wiki
Jump to: navigation, search
Lsa.2455
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90499341 (DY961199)
Gene Class Unknown
Domain Type LRR
Gene Species Lactuca sativa

Comment?

CLSM11552.b1_O07.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM11552, mRNA sequence

DNA Sequence

GGGGTCTCTGCTTTTTTCCCATATAGGAGAAGTCAAGAACTTCATGAAATAGAAACTGGGTCTCTACCAAAGCTTCAAGCTTTACCTTCATCAATGGCATAGTCACTTCCATCCAAGGTTGACATATACATAATGAAAAAACTTCAATTTGTAGCGGTTGCCACCATTATCTTCCTACTTCATAATCTTCATGAAACAACCGCTGACATCAGCAGTGACGCCCAGTCTCTTCTTCAATTCGCTTCATCGGTCCCACACGTAAGGCAGCTAAACTGGAATTCCACAATCCCAATCTGCAAATCTTGGGTTGGAATCACTTGTAACAATGAGGGAACTAAAGTTATTGCCATTCATTTACCGGGTCATGGACTATTCGGTCCAATTCCGCCCAATACCATCGGAAAGCTTGATTCCCTCAGAATCTTGAGCCTAAGATCCAATTTCCTAAACGGGTCTCTCCCTACTGATATCATCTCCATTCCCTCCCTCCAGTTTCTCTACCTTGAAAACAACAACTTTTCTGGTGAAATCCCTCTTAGTGTTTCTCCCCAAATTACCAATTTAGATCTCTCCTTCAATTCCTTCACAGGAAACATCCCGGAAACACTAAAAAACCTCACCCGTCTCACCTCCCTCAACCTCCAATTCAACTCCTTTTCGGGATCCGTTCCCGACCTCAACATCACCCGACTCCGTCTCTTAAACGTGAGTCATAACCAACTCAACGGTTCAATCCCGTCTTCCCTCCAAACTTTCCCGCTTTCTTCATTTTCCGGGAACGAACTCTTATGTGGGCCCCCGTTGAATCCATGCCCGGTTCCACCCCCATCCATGGCCTTACGCCCGaaaaaacacaccaaaaaaCTCAC


Protein sequences

Name Description Sequence
Lsa.2455 translated coding region predicted by ESTScan from UniGene Lsa.2455

GVSAFFPYRRSQELHEIETGSLPKLQALPSSMAXSLPSKVDIYIMKKLQFVAVATIIFLLHNLHETTADISSDAQSLLQFASSVPHVRQLNWNSTIPICKSWVGITCNNEGTKVIAIHLPGHGLFGPIPPNTIGKLDSLRILSLRSNFLNGSLPTDIISIPSLQFLYLENNNFSGEIPLSVSPQITNLDLSFNSFTGNIPETLKNLTRLTSLNLQFNSFSGSVPDLNITRLRLLNVSHNQLNGSIPSSLQTFPLSSFSGNELLCGPPLNPCPVPPPSMALRPKKHTKKLT


Domains

Domain Start-End Description Sequence

Seg: seg
27-38 seg

ALPSSMAXSLPS

HMMPanther: PTHR24420:SF779
33-283 SUBFAMILY NOT NAMED

AXSLPSKVDIYIMKKLQFVAVATIIFLLHNLHETTADISSDAQSLLQFASSVPHVRQLNWNSTIPICKSWVGITCNNEGTKVIAIHLPGHGLFGPIPPNTIGKLDSLRILSLRSNFLNGSLPTDIISIPSLQFLYLENNNFSGEIPLSVSPQITNLDLSFNSFTGNIPETLKNLTRLTSLNLQFNSFSGSVPDLNITRLRLLNVSHNQLNGSIPSSLQTFPLSSFSGNELLCGPPLNPCPVPPPSMALRPK

HMMPanther: PTHR24420
33-283 FAMILY NOT NAMED,FAMILY NOT NAMED

AXSLPSKVDIYIMKKLQFVAVATIIFLLHNLHETTADISSDAQSLLQFASSVPHVRQLNWNSTIPICKSWVGITCNNEGTKVIAIHLPGHGLFGPIPPNTIGKLDSLRILSLRSNFLNGSLPTDIISIPSLQFLYLENNNFSGEIPLSVSPQITNLDLSFNSFTGNIPETLKNLTRLTSLNLQFNSFSGSVPDLNITRLRLLNVSHNQLNGSIPSSLQTFPLSSFSGNELLCGPPLNPCPVPPPSMALRPK

superfamily: SSF52058
64-272 L domain-like,LRR

HETTADISSDAQSLLQFASSVPHVRQLNWNSTIPICKSWVGITCNNEGTKVIAIHLPGHGLFGPIPPNTIGKLDSLRILSLRSNFLNGSLPTDIISIPSLQFLYLENNNFSGEIPLSVSPQITNLDLSFNSFTGNIPETLKNLTRLTSLNLQFNSFSGSVPDLNITRLRLLNVSHNQLNGSIPSSLQTFPLSSFSGNELLCGPPLNPCP

HMMPfam: PF08263
IPR013210
71-108 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSDAQSLLQFASSVPHVRQLNWNSTIPICKSWVGITCN

Gene3D: G3DSA:3.80.10.10
83-265 no description

SVPHVRQLNWNSTIPICKSWVGITCNNEGTKVIAIHLPGHGLFGPIPPNTIGKLDSLRILSLRSNFLNGSLPTDIISIPSLQFLYLENNNFSGEIPLSVSPQITNLDLSFNSFTGNIPETLKNLTRLTSLNLQFNSFSGSVPDLNITRLRLLNVSHNQLNGSIPSSLQTFPLSSFSGNELLCG

HMMPfam: PF00560
IPR001611
162-180 LRR_1
Leucine-rich repeat

SLQFLYLENNNFSGEIPLS

HMMPfam: PF12799
184-225 LRR_4,Leucine Rich repeats (2 copies)

QITNLDLSFNSFTGNIPETLKNLTRLTSLNLQFNSFSGSVPD

HMMPfam: PF00560
IPR001611
230-250 LRR_1
Leucine-rich repeat

RLRLLNVSHNQLNGSIPSSLQ

Seg: seg
266-276 seg

PPLNPCPVPPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox