PRGDB00070616 (Lsa.8258)

From PRG Wiki
Jump to: navigation, search
Lsa.8258
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90498643 (DY960501)
Gene Class Unknown
Domain Type LRR
Gene Species Lactuca sativa

Comment?

CLSM10836.b1_G21.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM10836, mRNA sequence

DNA Sequence

CGCGGGGAAGTCAAATGTTTGACGAATTCTCTACAAGACCGCTATAAGTAAAAGGGACAGGGATCAGAGCTTGATTGAGTTCACAATAGTATCAAAATTATAAAAAAATGGATGATCTTGTGAATGATAACGACGATGGATCAGATGAAGCCAACGAAGAAGTTGTCAGGATACTGAAGCAGGCATCGGAGGAGGTCATCGATAGCGTTGACCTCTCTAGTCAACAGTTAAGGTTTCTTCCCGAAGCATTCGGCAAGCTTACCAGTTTAATTCATCTCAATCTCTCCAATAATCACTTACAGGTGCTTCCTGATTCAATTGCAGGATTAGTGAAACTAGAGGAGCTTGATGTTTCATCCAATCTTTTAGAATCATTACCAGATTCCATCGGCTTGTTGACATCTCTCAAAATCTTAAACATCTCAAGCAACAAGATCAACACCATTCCAGAAAGCATCGCCTTTTGCAAATCATTGGAGGAATTGTATGCAAGCTTCAATAACCTAATATTCTTGCCAACAAACTTCGGTTTTGGACTAATAAGCCTCAAAATCCTGTCAATCAGCCTCAACGAAATCCGTTTCCTTCCAACTACCATTAGTGAACTAGAATCTTTAAAATACCTAGATGCCCATTTCAACAAACTCCATGGCCTTCCATCTTCAATTGGGAAATTGTCAAATCTTGAGGTATTGAACTTGAGTGGTAACTTCAGCAATTTGACAGAGTTACCCGACACAATTACAAACCTTAAAAACCTCAGAGAACTTGATCTCAGTAACAACCAAATCAAGTCTCTTCCTGAATCATTCGGTCAACTTCAGAATCTGACCAAATTAAACTTAGATCAGAACCCGATTGTAGTTCCTCAATGGAGATTGTAATGGAAGGAACGGAGGCTGTGAAGGGCTTTATGGTCAATTGGCGGCTTTGCTATATAGCTGCTGAGGA


Protein sequences

Name Description Sequence
Lsa.8258 translated coding region predicted by ESTScan from UniGene Lsa.8258

MDDLVNDNDDGSDEANEEVVRILKQASEEVIDSVDLSSQQLRFLPEAFGKLTSLIHLNLSNNHLQVLPDSIAGLVKLEELDVSSNLLESLPDSIGLLTSLKILNISSNKINTIPESIAFCKSLEELYASFNNLIFLPTNFGFGLISLKILSISLNEIRFLPTTISELESLKYLDAHFNKLHGLPSSIGKLSNLEVLNLSGNFSNLTELPDTITNLKNLRELDLSNNQIKSLPESFGQLQNLTKLNLDQNPIVVPXMEIVMEGTEAVKGFMVNWRLCYIAAEX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF34
1-261 LEUCINE-RICH REPEAT-CONTAINING PROTEIN,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDDLVNDNDDGSDEANEEVVRILKQASEEVIDSVDLSSQQLRFLPEAFGKLTSLIHLNLSNNHLQVLPDSIAGLVKLEELDVSSNLLESLPDSIGLLTSLKILNISSNKINTIPESIAFCKSLEELYASFNNLIFLPTNFGFGLISLKILSISLNEIRFLPTTISELESLKYLDAHFNKLHGLPSSIGKLSNLEVLNLSGNFSNLTELPDTITNLKNLRELDLSNNQIKSLPESFGQLQNLTKLNLDQNPIVVPXMEIVME

HMMPanther: PTHR23155
1-261 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDDLVNDNDDGSDEANEEVVRILKQASEEVIDSVDLSSQQLRFLPEAFGKLTSLIHLNLSNNHLQVLPDSIAGLVKLEELDVSSNLLESLPDSIGLLTSLKILNISSNKINTIPESIAFCKSLEELYASFNNLIFLPTNFGFGLISLKILSISLNEIRFLPTTISELESLKYLDAHFNKLHGLPSSIGKLSNLEVLNLSGNFSNLTELPDTITNLKNLRELDLSNNQIKSLPESFGQLQNLTKLNLDQNPIVVPXMEIVME

Seg: seg
2-13 seg

DDLVNDNDDGSD

superfamily: SSF52058
33-251 L domain-like,LRR

SVDLSSQQLRFLPEAFGKLTSLIHLNLSNNHLQVLPDSIAGLVKLEELDVSSNLLESLPDSIGLLTSLKILNISSNKINTIPESIAFCKSLEELYASFNNLIFLPTNFGFGLISLKILSISLNEIRFLPTTISELESLKYLDAHFNKLHGLPSSIGKLSNLEVLNLSGNFSNLTELPDTITNLKNLRELDLSNNQIKSLPESFGQLQNLTKLNLDQNPI

HMMPfam: PF13855
33-87 LRR_8,Leucine rich repeat

SVDLSSQQLRFLPEAFGKLTSLIHLNLSNNHLQVLPDSIAGLVKLEELDVSSNLL

Gene3D: G3DSA:3.80.10.10
34-157 no description

VDLSSQQLRFLPEAFGKLTSLIHLNLSNNHLQVLPDSIAGLVKLEELDVSSNLLESLPDSIGLLTSLKILNISSNKINTIPESIAFCKSLEELYASFNNLIFLPTNFGFGLISLKILSISLNEI

Seg: seg
51-64 seg

LTSLIHLNLSNNHL

HMMSmart: SM00364
51-70 Leucine-rich repeats, bacterial type

LTSLIHLNLSNNHLQVLPDS

HMMSmart: SM00369
IPR003591
51-73 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLIHLNLSNNHLQVLPDSIAG

ProfileScan: PS51450
IPR001611
53-74 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIHLNLSNNHLQVLPDSIAGL

HMMSmart: SM00365
74-92 Leucine-rich repeat, SDS22-like subfamily

LVKLEELDVSSNLLESLPD

HMMSmart: SM00369
IPR003591
74-96 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVKLEELDVSSNLLESLPDSIGL

HMMSmart: SM00364
74-93 Leucine-rich repeats, bacterial type

LVKLEELDVSSNLLESLPDS

ProfileScan: PS51450
IPR001611
76-97 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEELDVSSNLLESLPDSIGLL

FPrintScan: PR00019
77-90 LEURICHRPT,Leucine-rich repeat signature

LEELDVSSNLLESL

HMMSmart: SM00365
97-119 Leucine-rich repeat, SDS22-like subfamily

LTSLKILNISSNKINTIPESIAF

HMMSmart: SM00364
97-116 Leucine-rich repeats, bacterial type

LTSLKILNISSNKINTIPES

HMMSmart: SM00369
IPR003591
97-120 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLKILNISSNKINTIPESIAFC

ProfileScan: PS51450
IPR001611
99-120 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILNISSNKINTIPESIAFC

HMMPfam: PF00560
IPR001611
99-118 LRR_1
Leucine-rich repeat

SLKILNISSNKINTIPESIA

HMMSmart: SM00364
120-139 Leucine-rich repeats, bacterial type

CKSLEELYASFNNLIFLPTN

HMMSmart: SM00369
IPR003591
121-143 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

KSLEELYASFNNLIFLPTNFGFG

ProfileScan: PS51450
IPR001611
122-143 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEELYASFNNLIFLPTNFGFG

HMMPfam: PF13855
122-180 LRR_8,Leucine rich repeat

SLEELYASFNNLIFLPTNFGFGLISLKILSISLNEIRFLPTTISELESLKYLDAHFNKL

Seg: seg
144-154 seg

LISLKILSISL

HMMSmart: SM00364
144-163 Leucine-rich repeats, bacterial type

LISLKILSISLNEIRFLPTT

HMMSmart: SM00369
IPR003591
144-166 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LISLKILSISLNEIRFLPTTISE

ProfileScan: PS51450
IPR001611
146-167 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILSISLNEIRFLPTTISEL

Gene3D: G3DSA:3.80.10.10
158-251 no description

RFLPTTISELESLKYLDAHFNKLHGLPSSIGKLSNLEVLNLSGNFSNLTELPDTITNLKNLRELDLSNNQIKSLPESFGQLQNLTKLNLDQNPI

HMMSmart: SM00369
IPR003591
167-189 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LESLKYLDAHFNKLHGLPSSIGK

HMMSmart: SM00365
167-195 Leucine-rich repeat, SDS22-like subfamily

LESLKYLDAHFNKLHGLPSSIGKLSNLEV

HMMSmart: SM00364
167-186 Leucine-rich repeats, bacterial type

LESLKYLDAHFNKLHGLPSS

ProfileScan: PS51450
IPR001611
169-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKYLDAHFNKLHGLPSSIGKL

HMMSmart: SM00369
IPR003591
190-214 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLEVLNLSGNFSNLTELPDTITN

HMMSmart: SM00364
190-211 Leucine-rich repeats, bacterial type

LSNLEVLNLSGNFSNLTELPDT

HMMPfam: PF13855
191-251 LRR_8,Leucine rich repeat

SNLEVLNLSGNFSNLTELPDTITNLKNLRELDLSNNQIKSLPESFGQLQNLTKLNLDQNPI

ProfileScan: PS51450
IPR001611
192-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLNLSGNFSNLTELPDTITNLK

FPrintScan: PR00019
215-228 LEURICHRPT,Leucine-rich repeat signature

LKNLRELDLSNNQI

HMMSmart: SM00369
IPR003591
215-238 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLRELDLSNNQIKSLPESFGQL

HMMSmart: SM00364
215-234 Leucine-rich repeats, bacterial type

LKNLRELDLSNNQIKSLPES

HMMSmart: SM00365
215-243 Leucine-rich repeat, SDS22-like subfamily

LKNLRELDLSNNQIKSLPESFGQLQNLTK

ProfileScan: PS51450
IPR001611
217-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRELDLSNNQIKSLPESFGQL

ProfileScan: PS51450
IPR001611
240-261 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTKLNLDQNPIVVPXMEIVME






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox