PRGDB00070636 (Lsa.9284)

From PRG Wiki
Jump to: navigation, search
Lsa.9284
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90499284 (DY961142)
Gene Class Unknown
Domain Type
Gene Species Lactuca sativa

Comment?

CLSM11495.b2_N18.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM11495, mRNA sequence

DNA Sequence

CGCGGGGCAAGGAGAGAGACAGGAGCAGGGTTTGTGTCACCGGAGGTGGTGGTTATATTGGGTCAGCCTTGGTTCACTCACTTCTACAAAGTGGCTACACTGTCCATGCTACTCTTAGAAACCTTGGTGATGAATCCAAGGTGGGGCTTTTGAGAGGTTTCCCATACGCTGAAGACGAGCTTCATTTGTTTGAAGCTGATATGTACAAACCAGAAGAGTTTGAAGAAGCAATACAAGGTTGTGTCTTTGTTTTCCATGTTGCAACCCCCTTGTTACACACTACTGGCTACAAGTACAATGATACGGTTGAAGCAACAATTAGTGCAGTGAAGATCGCAGATATTTGCATACGATCAAGGGCAGTGAAGCGTCTCATCTACACTGCCTCAGTTGTCGCAGCTTCACCTTTGAAAGATGATGGGAGTGGTTATAAGATCACCATAGATGAAAGTTGTTGGACACCCCTTCATCTCAATATCCCTTACAGCAATCATTTATTAAAAGTCGtttttaggaatttctttacatttttttGATTGATTAGGGTTATATTATATGTTACAAAGTTTCCAATTTGTTTGTGGGATTCTCTTTAGGAGTACACAGAAGCGAAAACAAAAGCCGAGCAAGAGATGTTGAAAATTGGGGAAGAGAAAGCAAGTGAACTAGAGGTGGTGACATTAAGCTGTGGATTGGTGGGAGGGAGAGGTCATCTACCATATGCTCCAGACAGTTTGTTGGTGTTGATATCACAAATTATCAATCCTTCGACTCATTACCAGTCACTAAAGTACTTGGAAGAATTGTTAGGAAAAATCCCGATTTTGCATATTGAGGACGCTTGTCGAGCACATATC


Protein sequences

Name Description Sequence
Lsa.9284 translated coding region predicted by ESTScan from UniGene Lsa.9284

XRGKERDRSRVCVTGGGGYIGSALVHSLLQSGYTVHATLRNLGDESKVGLLRGFPYAEDELHLFEADMYKPEEFEEAIQGCVFVFHVATPLLHTTGYKYNDTVEATISAVKIADICIRSRAVKRLIYTASVVAASPLKDDGSGYKITIDESCWTPLHLNIPYSNHLLKVVFRNFFTFFXLIRVILYVTKFPICLWDSLXEYTEAKTKAEQEMLKIGEEKASELEVVTLSCGLVGGRGHLPYAPDSLLVLISQIINPSTHYQSLKYLEELLGKIPILHIEDACRAHI

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
9-286 NAD(P)-binding Rossmann-fold domains

SRVCVTGGGGYIGSALVHSLLQSGYTVHATLRNLGDESKVGLLRGFPYAEDELHLFEADMYKPEEFEEAIQGCVFVFHVATPLLHTTGYKYNDTVEATISAVKIADICIRSRAVKRLIYTASVVAASPLKDDGSGYKITIDESCWTPLHLNIPYSNHLLKVVFRNFFTFFXLIRVILYVTKFPICLWDSLXEYTEAKTKAEQEMLKIGEEKASELEVVTLSCGLVGGRGHLPYAPDSLLVLISQIINPSTHYQSLKYLEELLGKIPILHIEDACRAHI

HMMPanther: PTHR10366:SF80
9-286 OS07G0601000 PROTEIN,OS07G0601000 PROTEIN

SRVCVTGGGGYIGSALVHSLLQSGYTVHATLRNLGDESKVGLLRGFPYAEDELHLFEADMYKPEEFEEAIQGCVFVFHVATPLLHTTGYKYNDTVEATISAVKIADICIRSRAVKRLIYTASVVAASPLKDDGSGYKITIDESCWTPLHLNIPYSNHLLKVVFRNFFTFFXLIRVILYVTKFPICLWDSLXEYTEAKTKAEQEMLKIGEEKASELEVVTLSCGLVGGRGHLPYAPDSLLVLISQIINPSTHYQSLKYLEELLGKIPILHIEDACRAHI

HMMPanther: PTHR10366
9-286 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

SRVCVTGGGGYIGSALVHSLLQSGYTVHATLRNLGDESKVGLLRGFPYAEDELHLFEADMYKPEEFEEAIQGCVFVFHVATPLLHTTGYKYNDTVEATISAVKIADICIRSRAVKRLIYTASVVAASPLKDDGSGYKITIDESCWTPLHLNIPYSNHLLKVVFRNFFTFFXLIRVILYVTKFPICLWDSLXEYTEAKTKAEQEMLKIGEEKASELEVVTLSCGLVGGRGHLPYAPDSLLVLISQIINPSTHYQSLKYLEELLGKIPILHIEDACRAHI

HMMPfam: PF01370
IPR001509
11-134 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGGGYIGSALVHSLLQSGYTVHATLRNLGDESKVGLLRGFPYAEDELHLFEADMYKPEEFEEAIQGCVFVFHVATPLLHTTGYKYNDTVEATISAVKIADICIRSRAVKRLIYTASVVAA

Gene3D: G3DSA:3.40.50.720
IPR016040
198-280 no description
NAD(P)-binding domain

LXEYTEAKTKAEQEMLKIGEEKASELEVVTLSCGLVGGRGHLPYAPDSLLVLISQIINPSTHYQSLKYLEELLGKIPILHIED

Coil: coil
198-199 coiled-coil

LX

Coil: coil
200-219 coiled-coil

EYTEAKTKAEQEMLKIGEEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox