PRGDB00070650 (Lsa.10343)

From PRG Wiki
Jump to: navigation, search
Lsa.10343
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90498959 (DY960817)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Lactuca sativa

Comment?

CLSM11164.b2_G07.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM11164, mRNA sequence

DNA Sequence

CTCTCTCATCTTGTCCTCCTTGTCCTTCTCTCCTTTTTGAGCTTTCTTTAATTATTTCTTACTCAAAAAGTCGAGGACACCTGTGTGGAGATGATTTTATACAATCATATCCAGTTTTAAGCTGATTCAGATAGGGTTCCATGGTTTGATCCCAAAAAGAACAAGATTCGGATTCACTTCTGGGAAGTTGACTGATTCCATATCTGATTAAAGTGGGGACGATAAGTTTTGGGAGGCTATGAAGTGTTTTCCATTCTCGTACTGCAACGAAAAAGACGAAGCCGCAAAAACGCCAACAAAATCGATATCGGTTCAATCTTTTACTTCCATATTTACAGATCGTGATGTGAGAAGATCATGGACGACAGGGTTAAACTCCGAAACTGTTTCCGACGTTAGCACAGAATCAATCGGAAGAAGGTCTAATGTTCCTAGTTTTTCACAGAGACCAAGTAATCTTCGAGTCTTCACTTTCCCCGAACTCAAATCGGCCACCAATGGCTTCAGCCGATCAGCAAAGATCGGCGAAGGTGGTTTCGGGTGTGTCTACATCGGCGCCATTAAATCCGATCAAGACCCGACGAAAAAGCTTCGTGTCGCCGTTAAACAGCTCAGCCGACGAGGGTTACAGGGACATAAGGAGTGGGTGACGGAGGTGAATGTTCTTGGGATTGTTGAACACCCGAATTTGGTGAAATTAATCGGGTATTGTGCAGAAGATGATGAAAGAGGTATTCAAAGGCTTCTGGTTTACGAATATATGCCGAATGGAAGTGTCGAGGATCATTTATGTGCTAAGAATGAAGAAACTCTTTCATGGAGTATGAGACTTNAAGTAGCTCAAGATGCTGCTCGTGGGTTGACTTATTTACACGAGGGAATGGGCTTTCAGATCATCTTCCGAGATTTCAATCATCCAACATTCTTCT


Protein sequences

Name Description Sequence
Lsa.10343 translated coding region predicted by ESTScan from UniGene Lsa.10343

MKCFPFSYCNEKDEAAKTPTKSISVQSFTSIFTDRDVRRSWTTGLNSETVSDVSTESIGRRSNVPSFSQRPSNLRVFTFPELKSATNGFSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRDFNHPTFFX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF641
10-224 SUBFAMILY NOT NAMED

NEKDEAAKTPTKSISVQSFTSIFTDRDVRRSWTTGLNSETVSDVSTESIGRRSNVPSFSQRPSNLRVFTFPELKSATNGFSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRDF

HMMPanther: PTHR24420
10-224 FAMILY NOT NAMED,FAMILY NOT NAMED

NEKDEAAKTPTKSISVQSFTSIFTDRDVRRSWTTGLNSETVSDVSTESIGRRSNVPSFSQRPSNLRVFTFPELKSATNGFSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRDF

superfamily: SSF56112
IPR011009
59-223 Protein kinase-like (PK-like)
Protein kinase-like domain

GRRSNVPSFSQRPSNLRVFTFPELKSATNGFSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRD

Gene3D: G3DSA:3.30.200.20
69-172 no description

QRPSNLRVFTFPELKSATNGFSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVY

ProfileScan: PS50011
IPR000719
89-231 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRDFNHPTFFX

HMMSmart: SM00219
IPR020635
89-230 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRDFNHPTFF

HMMSmart: SM00220
IPR002290
89-229 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSRSAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRDFNHPTF

HMMPfam: PF07714
IPR001245
92-214 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SAKIGEGGFGCVYIGAIKSDQDPTKKLRVAVKQLSRRGLQGHKEWVTEVNVLGIVEHPNLVKLIGYCAEDDERGIQRLLVYEYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEG

PatternScan: PS00107
IPR017441
95-123 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGCVYIGAIKSDQDPTKKLRVAVK

Gene3D: G3DSA:1.10.510.10
173-223 no description

EYMPNGSVEDHLCAKNEETLSWSMRLXVAQDAARGLTYLHEGMGFQIIFRD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox