PRGDB00070674 (Lsa.12115)

From PRG Wiki
Jump to: navigation, search
Lsa.12115
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90500874 (DY962732)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Lactuca sativa

Comment?

CLSM13012.b1_H14.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM13012, mRNA sequence

DNA Sequence

CTCCATATCTTTGAAGAAAATTGAATCAAAATCATGGGTCTTTGTGCATCAGCTCCAAAATCAAGAACAAACCCAGAAAGGAATCAGTTTCAGAACCATCAAAAAAGCAATCTTTTTAGCTATAATCAAACAAACCCACCTTCCACCAACAGCCCACAAAAGTTTTCCGGCCAGGTTCCGCCGCAAACCACCACAAGTCCtggtggcggtggtgcaggtggtggtggtggtggtggtgCTACTCCTTCTTTCTCTGAATTCTCTTTCGCCGACCTAAAAACTGCTACTAATAATTTCAGTACAGATTTAATTGTATCTGAAAGTGGTGAAAAAGCACCCAATCTTGTGTATAAAGGAAGGCTCAAGAATCGTCGGTGGATTGCTGTCAAGAAATTCTCCAAATTGGCATGGCCGGACCCTAAACAATTTGCGGAGGAAGCATGGGGTGTAGGGAAGCTGCGACATAAAAGGCTGGCTAATTTAATCGGTTATTGTTGTGATGGTGAAGAGAGGTTGCTTGTTGCTGAGTACATGCCAAATGACACTCTTGCTAAGCATTTATTTCACTGGGAAAATCAAACAATCGAGTGGGCTATGCGAATAAGGGTGGCTCAATACATATCCGATGCCTTAAACTATTGTAGCACCGAAGGTCGTGAAGTGTATCATGACCTCAATGCCTATAGGGTTCTCTTTGACGAGGAGGGAGATCCCCGCCTTTCATGTTTTGGATTCATGAGAAACAGTCGGGATGGAAAAAGCTATAGCACGAATCTTGCATATACGCCTCCAGAATATCTCAAACATGGAAGAGTCACCCCAGAGAGCGTTGTATATAGCTTTGGAACAGTTCTTTT


Protein sequences

Name Description Sequence
Lsa.12115 translated coding region predicted by ESTScan from UniGene Lsa.12115

MGLCASAPKSRTNPERNQFQNHQKSNLFSYNQTNPPSTNSPQKFSGQVPPQTTTSPGGGGAGGGGGGGATPSFSEFSFADLKTATNNFSTDLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVLX

Domains

Domain Start-End Description Sequence

Seg: seg
57-69 seg

GGGGAGGGGGGGA

superfamily: SSF56112
IPR011009
60-274 Protein kinase-like (PK-like)
Protein kinase-like domain

GAGGGGGGGATPSFSEFSFADLKTATNNFSTDLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVL

HMMPanther: PTHR24420:SF885
71-274 SUBFAMILY NOT NAMED

PSFSEFSFADLKTATNNFSTDLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVL

HMMPanther: PTHR24420
71-274 FAMILY NOT NAMED,FAMILY NOT NAMED

PSFSEFSFADLKTATNNFSTDLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVL

Gene3D: G3DSA:3.30.200.20
72-153 no description

SFSEFSFADLKTATNNFSTDLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGY

ProfileScan: PS50011
IPR000719
91-275 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVLX

HMMPfam: PF07714
IPR001245
105-274 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVL

Gene3D: G3DSA:1.10.510.10
154-274 no description

CCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVVYSFGTVL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox