PRGDB00070693 (Lsa.12990)

From PRG Wiki
Jump to: navigation, search
Lsa.12990
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90499932 (DY961790)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Lactuca sativa

Comment?

CLSM12122.b1_C08.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM12122, mRNA sequence

DNA Sequence

CGCGGGATTTGCGAGTTGCAGAGCCAGAGCTCCGGCGACCATAGTGAAATGCATGTTTTCGAAGGGGGTAATGTCGTAATTTCAATTCAAGTTCTCCGACAAGTCACGAACAATTTCAGTGAAGATAACATACTAGGAAGAGGTGGATTTGGGGTCGTTTACAAAGGGGAATTACACGATGGAACAAAAATTGCAGTCAAAAGAATGGAATCGGGTGTCATGGGAACAAAAGGGTTAAACGAATTTCAAGCTGAAATTGTGGTTCTCACTAAGGTTAGACATAGACATTTAGTGGCACTTCTTGGGTATTGTATCAATGGAAATGAGCGACTTTTGGTGTATGAGTATATGCCACAAGGGACTTTAAGTCAACATTTGTTTGAATGGAGTGAACATAAGACACCTCCACTTAGTTGGAAACAAAGGGTTTCGATTGCTTTAGATGTGGGAAGAGGGGTTGAGTATTTGCATAGTTTGGCACAACAAAGTTTTATTCATAGAGATTTGAAACCTTCAAATATTCTTCTTGGTGATGATATGAGGGCTAAAGTTGCGGATTTTGGTTTGGTTAAGAATGCACCGGATGGGAAGTATTCGGTTGAGACACGACTTGCGGGGACTTTCGGTTATCTTGCACCCGAGTATGCTGCAACCGGAAGAGTGACAACAAAGGTCGATGTTTTCGCATTCGGCGTGGTGTTAATGGAGTTGATAACGGGCCGAANAGCCCTAGACGAAACAATGCCTGACGAGCGGTGTCATTTGGTGACATGGTTCCGAAGAGTCCTCATCTCANAAGAAACATGCTAAAAGCCATTGA


Protein sequences

Name Description Sequence
Lsa.12990 translated coding region predicted by ESTScan from UniGene Lsa.12990

RGICELQSQSSGDHSEMHVFEGGNVVISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDETMPDXAVSFGDMVPKSPHLXRNMLKAIX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF467
7-250 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QSQSSGDHSEMHVFEGGNVVISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDETMPD

HMMPanther: PTHR24420
7-250 FAMILY NOT NAMED,FAMILY NOT NAMED

QSQSSGDHSEMHVFEGGNVVISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDETMPD

superfamily: SSF56112
IPR011009
11-246 Protein kinase-like (PK-like)
Protein kinase-like domain

SGDHSEMHVFEGGNVVISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDE

Gene3D: G3DSA:3.30.200.20
25-102 no description

VVISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLG

ProfileScan: PS50011
IPR000719
39-274 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDETMPDXAVSFGDMVPKSPHLXRNMLKAIX

HMMSmart: SM00220
IPR002290
39-273 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDETMPDXAVSFGDMVPKSPHLXRNMLKAI

HMMSmart: SM00219
IPR020635
39-269 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEDNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDETMPDXAVSFGDMVPKSPHLXRNM

HMMPfam: PF00069
IPR017442
42-247 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DNILGRGGFGVVYKGELHDGTKIAVKRMESGVMGTKGLNEFQAEIVVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDET

PatternScan: PS00107
IPR017441
45-67 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGVVYKGELHDGTKIAVK

Gene3D: G3DSA:1.10.510.10
103-246 no description

YCINGNERLLVYEYMPQGTLSQHLFEWSEHKTPPLSWKQRVSIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVVLMELITGRXALDE

PatternScan: PS00108
IPR008271
164-176 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox