PRGDB00070700 (Lsa.13768)

From PRG Wiki
Jump to: navigation, search
Lsa.13768
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90497504 (DY959362)
Gene Class Unknown
Domain Type LRR
Gene Species Lactuca sativa

Comment?

CLSL1321.b1_B19.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSL1321, mRNA sequence

DNA Sequence

GGCGGGGCGCGTTGTCTCGTCCTGAAATCGCCCACTCCCTCTGAGATCTTACTCGGAAACACAGTCTTTGATCTGTATTCCTATGGACTTGATGTATAGTTATATACACTCAGACATACAATTTACGGACGAATGTTGATTTGAATTTCGAAAGCAAAAAAGGATTCTAAATCGACATCAATAATGTTGCGTCTCGGAGTATCTACAGGATTTTCATCGATCATATTACTTTTTTGCCTTCTCAGCGTTTCTGTGCACTGCAAAACCCTAAAAAGAGACGTGAAAGCTCTTAACGAAATTAAAGCATCTCTTGGATGGAGAGTGGTGTATGCATGGGTTGGAGATGATCCATGTGGAGATGGTGATTTACCAGCTTGGTCTGGTGTCACATGCTCCACACAAGGTGATTATAGAGTGGTTACTGAACTGGAAGTATATGCAGTTTCAATTGTGGGACCCTTTCCTACTGCAGTAACCAATCTACTGGATCTTACTAGATTGGATCTCCACAACAATAAGTTGACTGGTCCAATCCCACCTCAAATTGGGCGATTAAAGCGGCTTAAGATACTTAATCTGAGGTGGAATAAGCTGCAGGATGTAATTCCTCCTGAAATAGGTGAACTAAAGAAATTAACACACCTCTACTTAAGTTTCAATAGCTCTAAAGGGGAAATACCAAGGGAGCTAGCTAATCTTCCAGAATTGCAGCATCTTCATCTGCATCAAAATCGGTTAATTGGGCGTATTCCACATGAATTGGGCTCTTTACAAAATCTTCGCCATTTGGATGTTGGTGATAATCATTTGGTTGGAACTATTAGGGAACTGATACGTATAGATGGATGTTTTCCAGCTCTTCGCAATCTATATCTAAATAACAACTATCAGACTGGAGGTATTCCAACTCAACTTGAAAACTTGAACCATCTGGAAATTCTGC


Protein sequences

Name Description Sequence
Lsa.13768 translated coding region predicted by ESTScan from UniGene Lsa.13768

MLRLGVSTGFSSIILLFCLLSVSVHCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKKLTHLYLSFNSSKGEIPRELANLPELQHLHLHQNRLIGRIPHELGSLQNLRHLDVGDNHLVGTIRELIRIDGCFPALRNLYLNNNYQTGGIPTQLENLNHLEILX


Domains

Domain Start-End Description Sequence

Seg: seg
10-24 seg

FSSIILLFCLLSVSV

HMMPanther: PTHR24420:SF518
13-253 PROTEIN BINDING

IILLFCLLSVSVHCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKKLTHLYLSFNSSKGEIPRELANLPELQHLHLHQNRLIGRIPHELGSLQNLRHLDVGDNHLVGTIRELIRIDGCFPALRNLYLNNNYQTGGIPTQLENLNHLEIL

HMMPanther: PTHR24420
13-253 FAMILY NOT NAMED,FAMILY NOT NAMED

IILLFCLLSVSVHCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKKLTHLYLSFNSSKGEIPRELANLPELQHLHLHQNRLIGRIPHELGSLQNLRHLDVGDNHLVGTIRELIRIDGCFPALRNLYLNNNYQTGGIPTQLENLNHLEIL

superfamily: SSF52058
26-254 L domain-like,LRR

CKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKKLTHLYLSFNSSKGEIPRELANLPELQHLHLHQNRLIGRIPHELGSLQNLRHLDVGDNHLVGTIRELIRIDGCFPALRNLYLNNNYQTGGIPTQLENLNHLEILX

Gene3D: G3DSA:3.80.10.10
64-253 no description

AWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPPEIGELKKLTHLYLSFNSSKGEIPRELANLPELQHLHLHQNRLIGRIPHELGSLQNLRHLDVGDNHLVGTIRELIRIDGCFPALRNLYLNNNYQTGGIPTQLENLNHLEIL

HMMSmart: SM00369
IPR003591
100-123 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLDLTRLDLHNNKLTGPIPPQIGR

HMMPfam: PF00560
IPR001611
103-123 LRR_1
Leucine-rich repeat

LTRLDLHNNKLTGPIPPQIGR

HMMSmart: SM00369
IPR003591
124-148 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKRLKILNLRWNKLQDVIPPEIGEL

HMMPfam: PF12799
125-159 LRR_4,Leucine Rich repeats (2 copies)

KRLKILNLRWNKLQDVIPPEIGELKKLTHLYLSFN

HMMSmart: SM00369
IPR003591
172-196 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPELQHLHLHQNRLIGRIPHELGSL

HMMPfam: PF12799
173-209 LRR_4,Leucine Rich repeats (2 copies)

PELQHLHLHQNRLIGRIPHELGSLQNLRHLDVGDNHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox