PRGDB00070725 (Mdo.171)

From PRG Wiki
Jump to: navigation, search
Mdo.171
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226741648 (GO497488)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

NP_194455.2| dihydroflavonol 4-reductase (dihydrokaempferol 4-reductase) family [Arabidopsis thaliana] gb|AAN13064.1| unknown protein [Arabidopsis thaliana], mRNA sequence

DNA Sequence

ATCGAATTCCGTTGCTGTCGGAAAGTGAGAGCTATGGCAACTTACTGTGTTACCGGAGCCACTGGTTTTATAGGGTCTTGGTTGGTGAAGAGCCTCCTGGAGAAAGGCCACATGGTTCATGCCACAGTCCGTGATCCTGCCAAGTGTTTGCACCTATTATCATTGTGGACAAGCATTGACCGGTTGAGATTGCTCCGAGCGGATTTGGGAGAAGAAGGAAGCTTCGACGAGGCTGTGAAGGGCTGTGACGGTGTATTTCACGTTGCAGCATCCATGGAATTCAGTGTTACTGTCAAAGAAAACATTGAGAGTTATGTTCGATCAAATATCATTGAGCCTGCGATCAAAGGAACCTTAGACCTCCTCAAATCCTGTGTGAATTCCGGAACGGTGAAAAGGGTTGTACTCACCTCTTCCATTAGTACTATCACCGCCAAAGACGGAAACGGAAATGCAAGAGTTGTTGTTGATGAGTCTTGCCAAACTCCAGTTGATCAAGTTCTAACTACAAAAGCAAATGGATGGGTTTATGTACTTTTGAAGATTCTCACGGAGGAAGCAGCATTCAAATTTGCAAGTGAGAAAGGGATTAATCTTGTATCAGTCATAACAAGTACTGTTGGGGGGCCTTTTCTCACTTCCAAAGTTCCATCAAGCATTCAAGTTCTTCTTTCTCCAGTAACAGGTGACCCCTGAACTCTATGGCATA


Protein sequences

Name Description Sequence
Mdo.171 translated coding region predicted by ESTScan from UniGene Mdo.171

IEFRCCRKVRAMATYCVTGATGFIGSWLVKSLLEKGHMVHATVRDPAKCLHLLSLWTSIDRLRLLRADLGEEGSFDEAVKGCDGVFHVAASMEFSVTVKENIESYVRSNIIEPAIKGTLDLLKSCVNSGTVKRVVLTSSISTITAKDGNGNARVVVDESCQTPVDQVLTTKANGWVYVLLKILTEEAAFKFASEKGINLVSVITSTVGGPFLTSKVPSSIQVLLSPVTGDP

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
12-224 NAD(P)-binding Rossmann-fold domains

MATYCVTGATGFIGSWLVKSLLEKGHMVHATVRDPAKCLHLLSLWTSIDRLRLLRADLGEEGSFDEAVKGCDGVFHVAASMEFSVTVKENIESYVRSNIIEPAIKGTLDLLKSCVNSGTVKRVVLTSSISTITAKDGNGNARVVVDESCQTPVDQVLTTKANGWVYVLLKILTEEAAFKFASEKGINLVSVITSTVGGPFLTSKVPSSIQVLL

HMMPanther: PTHR10366:SF9
14-230 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

TYCVTGATGFIGSWLVKSLLEKGHMVHATVRDPAKCLHLLSLWTSIDRLRLLRADLGEEGSFDEAVKGCDGVFHVAASMEFSVTVKENIESYVRSNIIEPAIKGTLDLLKSCVNSGTVKRVVLTSSISTITAKDGNGNARVVVDESCQTPVDQVLTTKANGWVYVLLKILTEEAAFKFASEKGINLVSVITSTVGGPFLTSKVPSSIQVLLSPVTGD

HMMPanther: PTHR10366
14-230 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

TYCVTGATGFIGSWLVKSLLEKGHMVHATVRDPAKCLHLLSLWTSIDRLRLLRADLGEEGSFDEAVKGCDGVFHVAASMEFSVTVKENIESYVRSNIIEPAIKGTLDLLKSCVNSGTVKRVVLTSSISTITAKDGNGNARVVVDESCQTPVDQVLTTKANGWVYVLLKILTEEAAFKFASEKGINLVSVITSTVGGPFLTSKVPSSIQVLLSPVTGD

Gene3D: G3DSA:3.40.50.720
IPR016040
14-224 no description
NAD(P)-binding domain

TYCVTGATGFIGSWLVKSLLEKGHMVHATVRDPAKCLHLLSLWTSIDRLRLLRADLGEEGSFDEAVKGCDGVFHVAASMEFSVTVKENIESYVRSNIIEPAIKGTLDLLKSCVNSGTVKRVVLTSSISTITAKDGNGNARVVVDESCQTPVDQVLTTKANGWVYVLLKILTEEAAFKFASEKGINLVSVITSTVGGPFLTSKVPSSIQVLL

HMMPfam: PF01370
IPR001509
16-211 Epimerase
NAD-dependent epimerase/dehydratase

CVTGATGFIGSWLVKSLLEKGHMVHATVRDPAKCLHLLSLWTSIDRLRLLRADLGEEGSFDEAVKGCDGVFHVAASMEFSVTVKENIESYVRSNIIEPAIKGTLDLLKSCVNSGTVKRVVLTSSISTITAKDGNGNARVVVDESCQTPVDQVLTTKANGWVYVLLKILTEEAAFKFASEKGINLVSVITSTVGGPF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox