PRGDB00070730 (Mdo.642)

From PRG Wiki
Jump to: navigation, search
Mdo.642
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 46604027 (CN489749)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

Mdfw2024e20.y1 Mdfw Malus x domestica cDNA clone Mdfw2024e20 5' similar to TR:Q9XID3 Q9XID3 HYPOTHETICAL 91.3 KD PROTEIN F23M19.5. ;, mRNA sequence

DNA Sequence

TTGGCCAAGCTTTTGGGAACGGACCAAACTCAAACTACTACTCGAATCAGGGGAACCAAAGGTTATGTAGCCCCTGAATGGTTCAAAAACATGCCTATCACAATGAAGGTGGATGTTTACAGCTATGGCATTTTGTTACTAGAAATTATTTGTTGCAGGAAGAATTTTGAAGAACATGCGGATGATGTAGATCAGCTGATACTAGCTTATTGGGCATATGATTGCTATATGCAAAAGGAGCTGCATTTGCTATTGGAGAAGGACGAAGAAGCGATGGAAGACGTCAAGATGATGGAGAATTACGTGATGATTGCAATGTGGTGCATTCAGGAGGACCCATCACTGAGACCGACGATGAAGAAAGTCACGCAGATGCTTGAAGGAACTGTTGAAGTCTCAGTTCCACCGAATCCATCGTCATTTATGAGTAATAGTTTAAGTGGTTGTTTCCTTGTTATTTGATCATCGAAAACTCAAAATCTTGAACTTTGTAGTTCATAGATAGTCCTTCATAATTTTTTGTTGAAAGAATGATTGTACATGTTGAAGAAAGTTTATGTTCCATCATATTTGCGCaaaaaaaaaaaaaaaaaaT


Protein sequences

Name Description Sequence
Mdo.642 translated coding region predicted by ESTScan from UniGene Mdo.642

LAKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQMLEGTVEVSVPPNPSSFMSNSLSGCFLVI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-130 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LAKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQMLEGTV

superfamily: SSF56112
IPR011009
1-126 Protein kinase-like (PK-like)
Protein kinase-like domain

LAKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQML

HMMPanther: PTHR24420:SF845
1-142 OS04G0202500 PROTEIN

LAKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQMLEGTVEVSVPPNPSSFM

HMMPanther: PTHR24420
1-142 FAMILY NOT NAMED,FAMILY NOT NAMED

LAKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQMLEGTVEVSVPPNPSSFM

Gene3D: G3DSA:1.10.510.10
2-126 no description

AKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQML

HMMPfam: PF00069
IPR017442
2-124 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

AKLLGTDQTQTTTRIRGTKGYVAPEWFKNMPITMKVDVYSYGILLLEIICCRKNFEEHADDVDQLILAYWAYDCYMQKELHLLLEKDEEAMEDVKMMENYVMIAMWCIQEDPSLRPTMKKVTQ

Seg: seg
79-90 seg

KELHLLLEKDEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox