PRGDB00070802 (Mdo.7647)

From PRG Wiki
Jump to: navigation, search
Mdo.7647
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71814186 (DR991577)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

NP_567679.2| serine

DNA Sequence

CACGAGGATCTGATTTTGGCATGGCCAGGATCTTTGGGGTTGATCAAACTCAAGCAAACACAAATAGAATTGTCTGAACATATGGTTATATGTCTCCCGAGTACGCAATGCACGGGCAATTTTCTGTCAAATCCGATCTGTATAGTTTCGGTGTTTTAGTGCTAGAAATTATCAGTGGCAAGAAGAACAGTAACTTCTTTCAGACCGATGTAGCTGAGGACCTCACAAGCCATGCTTGGAAATTATGGAGAGACGGGACATCTTTGGAACTGTTGGATCCGTGTCTAAGAGACTCTTATTCAAGGATTGAAGTAATCAGATGCATCCACATCGGCTTACTTTGTGTTCAGGAAGATCCAGCTGACAGGCCTACAATGCAATCGGTGGTTCTCATGCTCAATAGCTACTCTGTTAGTCTGGCATTACCTAAACAACCGGCATTTTTCCTCCAAAGCAGGCCAATGGGGAACATGTCAAAGATAACGCTGGAGTCCGATCAATCTATCAACAAGTCATCTCCGTCTGTTTATGAAGGATCTATCACTGAAGTATACCCTAGATAGTGTGCATAAATAAGGTGTTAGATCTATTGTAATTTAAGTTTATCAACCCACTGCTTTGCAATCTATGG


Protein sequences

Name Description Sequence
Mdo.7647 translated coding region predicted by ESTScan from UniGene Mdo.7647

XRGSDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYSVSLALPKQPAFFLQSRPMGNMSKITLESDQSINKSSPSVYEGSITEVYPR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-148 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRGSDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYSVSLALPKQPAF

Gene3D: G3DSA:1.10.510.10
4-131 no description

SDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVL

HMMPanther: PTHR24420:SF430
4-185 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYSVSLALPKQPAFFLQSRPMGNMSKITLESDQSINKSSPSVYEGSITEVY

HMMPanther: PTHR24420
4-185 FAMILY NOT NAMED,FAMILY NOT NAMED

SDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYSVSLALPKQPAFFLQSRPMGNMSKITLESDQSINKSSPSVYEGSITEVY

HMMPfam: PF07714
IPR001245
4-132 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLM

superfamily: SSF56112
IPR011009
4-164 Protein kinase-like (PK-like)
Protein kinase-like domain

SDFGMARIFGVDQTQANTNRIVXTYGYMSPEYAMHGQFSVKSDLYSFGVLVLEIISGKKNSNFFQTDVAEDLTSHAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYSVSLALPKQPAFFLQSRPMGNMSKITLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox