PRGDB00070810 (Mdo.8170)

From PRG Wiki
Jump to: navigation, search
Mdo.8170
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 46601373 (CN488605)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

Mdfw2026n20.y1 Mdfw Malus x domestica cDNA clone Mdfw2026n20 5' similar to TR:O65152 O65152 PUTATIVE CINNAMYL ALCOHOL DEHYDROGENASE. ;, mRNA sequence

DNA Sequence

AGAGAGAGATGAGTACTGTAGAAGGGAAGACTGTGTGCGTAACAGGAGCCTCAGGTTACATCGCATCATGGCTGGTGAAGCTCTTATTGCAAAAGGGTTATACTGTCAGAGGCACTGTTCGTGACCCAAATGATTCAAAGAAAACAGAACACTTGCGCTCATTAGACGGAGCCAAAGAAAGGCTTCATTTGTTCAAAGCAGATTTATTAGAAGAAGGGTCTTTCGACGCCGTAGTTGATGGATGCCAAGGTGTTTTTCATACAGCGTCCCCTGTACTCCTTTCAGTCACTGACCCTCAGGGGGAACTACTTGACCCTGCAGTGAAGGGAACACTTAATGTTCTACAATCATGCGCGAAATTTCGTAGCATCACGAGAGTGGTTTTAACATCTTCACTTGCTTCAGTAATGATGACTGGAGCCCCTCTGACCTCTGATGTGGTTTTGGATGAAACATGGTATTCGGATCCACTTTTTTGTGAGAAGCACAAGCAATGGTATTTGCTCTCAAAAACTTTAGCCGAGGAGACTGCCTGGAAATTTGCTAAAGGAAATGGGATTGACTTGGTGTCGTTGAATCCAGGGTTAACCATTGGTCCACTC


Protein sequences

Name Description Sequence
Mdo.8170 translated coding region predicted by ESTScan from UniGene Mdo.8170

XREMSTVEGKTVCVTGASGYIASWLVKLLLQKGYTVRGTVRDPNDSKKTEHLRSLDGAKERLHLFKADLLEEGSFDAVVDGCQGVFHTASPVLLSVTDPQGELLDPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHKQWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGPL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
2-201 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

REMSTVEGKTVCVTGASGYIASWLVKLLLQKGYTVRGTVRDPNDSKKTEHLRSLDGAKERLHLFKADLLEEGSFDAVVDGCQGVFHTASPVLLSVTDPQGELLDPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHKQWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGPL

HMMPanther: PTHR10366
2-201 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

REMSTVEGKTVCVTGASGYIASWLVKLLLQKGYTVRGTVRDPNDSKKTEHLRSLDGAKERLHLFKADLLEEGSFDAVVDGCQGVFHTASPVLLSVTDPQGELLDPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHKQWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGPL

superfamily: SSF51735
4-201 NAD(P)-binding Rossmann-fold domains

MSTVEGKTVCVTGASGYIASWLVKLLLQKGYTVRGTVRDPNDSKKTEHLRSLDGAKERLHLFKADLLEEGSFDAVVDGCQGVFHTASPVLLSVTDPQGELLDPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHKQWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGPL

Gene3D: G3DSA:3.40.50.720
IPR016040
10-200 no description
NAD(P)-binding domain

KTVCVTGASGYIASWLVKLLLQKGYTVRGTVRDPNDSKKTEHLRSLDGAKERLHLFKADLLEEGSFDAVVDGCQGVFHTASPVLLSVTDPQGELLDPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHKQWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGP

HMMPfam: PF01370
IPR001509
12-200 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGYIASWLVKLLLQKGYTVRGTVRDPNDSKKTEHLRSLDGAKERLHLFKADLLEEGSFDAVVDGCQGVFHTASPVLLSVTDPQGELLDPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHKQWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox