PRGDB00070813 (Mdo.8339)

From PRG Wiki
Jump to: navigation, search
Mdo.8339
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71813993 (DR991384)
Gene Class Unknown
Domain Type LRR
Gene Species Malus x domestica

Comment?

CAC40827.1| HcrVf3 protein [Malus floribunda], mRNA sequence

DNA Sequence

CACGAGGAACAATTGCAGCGTAGAACTTCTTCACAAGGCGATTTTGGAACTGAGAAAATGCATTGCTCCATGACAAATTAGACAACAATGAACCAAGAAAAATCCAAAACCCGAATGCAAAACCCAGCCCCAAACTCAAATAGAAACCACTGTCTTCAAGTAAATGACCTTCTCTGTGCTTCTCATCACCTACCGGTGGCATGGCCTCATTTGTACTGCAATGCTCTTCCAATGGAGGTCCACAAAGTTTATTGCCTGCATAACTGGACAAATCAAAGCTCTGAAGCTGAGTGCTTATTGGAATTTGCCCAACCAGATTGTTATTGGACAAATTCAAATGATTAAGAAATGTCAATTTTGAGATGCTTGGAGAAATTTCCCCACAAAGTTGGTTCACAGACAAATCAAGCGACTCTAACGCTCCCATATCACCGATTTTGGAAGGAATTCTTCCGATCAAAAGATTATCCGATAAATTCAATGTTTGTAGGCTAATGAGGTTGGTCAGCTCTTCAGGGATTTCTCCAGATAACATGTTTCTTGAAAGGTCCAAGCTAGTTACCAAACGAAGCACTGTGTTATATTTCACTTCTCTGCCTTTGGCCACAAAAACCGCATTCTCTATGTAGGAGATGGAGAACAGAAAAGTAGATGGACCAGACATTGAAGAAACAAAGAATTCAATACTGAGATTTTCTTCGCTTGAAAATTTAGTGGCCA


Protein sequences

Name Description Sequence
Mdo.8339 translated coding region predicted by ESTScan from UniGene Mdo.8339

XATKFSSEENLSIEFFVSSMSGPSTFLFSISYIENAVFVAKGREVKYNTVLRLVTSLDLSRNMLSGEIPEELTNLISLQTLNLSDNLLIGRIPSKIGDMGALESLDLSVNQLCGEISPSISKLTFLNHLNLSNNNLVGQIPISTQLQSFDLSSYAGNKLCGPPLEEHCSTNEAMPPVGDEKHREGHLLEDSGFYLSLGLGFAFGFWIFLGSLLSNLSWSNAFSQFQNRLVKKFYAAIVPRX


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
3-153 L domain-like,LRR

TKFSSEENLSIEFFVSSMSGPSTFLFSISYIENAVFVAKGREVKYNTVLRLVTSLDLSRNMLSGEIPEELTNLISLQTLNLSDNLLIGRIPSKIGDMGALESLDLSVNQLCGEISPSISKLTFLNHLNLSNNNLVGQIPISTQLQSFDLSS

Gene3D: G3DSA:3.80.10.10
53-153 no description

LVTSLDLSRNMLSGEIPEELTNLISLQTLNLSDNLLIGRIPSKIGDMGALESLDLSVNQLCGEISPSISKLTFLNHLNLSNNNLVGQIPISTQLQSFDLSS

FPrintScan: PR00019
54-67 LEURICHRPT,Leucine-rich repeat signature

VTSLDLSRNMLSGE

HMMPfam: PF00560
IPR001611
55-75 LRR_1
Leucine-rich repeat

TSLDLSRNMLSGEIPEELTNL

HMMPanther: PTHR24420:SF478
57-161 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LDLSRNMLSGEIPEELTNLISLQTLNLSDNLLIGRIPSKIGDMGALESLDLSVNQLCGEISPSISKLTFLNHLNLSNNNLVGQIPISTQLQSFDLSSYAGNKLCG

HMMPanther: PTHR24420
57-161 FAMILY NOT NAMED,FAMILY NOT NAMED

LDLSRNMLSGEIPEELTNLISLQTLNLSDNLLIGRIPSKIGDMGALESLDLSVNQLCGEISPSISKLTFLNHLNLSNNNLVGQIPISTQLQSFDLSSYAGNKLCG

HMMPfam: PF00560
IPR001611
77-95 LRR_1
Leucine-rich repeat

SLQTLNLSDNLLIGRIPSK

HMMPfam: PF00560
IPR001611
102-123 LRR_1
Leucine-rich repeat

LESLDLSVNQLCGEISPSISKL

Seg: seg
123-136 seg

LTFLNHLNLSNNNL

FPrintScan: PR00019
123-136 LEURICHRPT,Leucine-rich repeat signature

LTFLNHLNLSNNNL

HMMPfam: PF00560
IPR001611
126-143 LRR_1
Leucine-rich repeat

LNHLNLSNNNLVGQIPIS

Seg: seg
209-220 seg

LGSLLSNLSWSN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox